Sequence Similarity Clusters for the Entities in PDB 6IAP

Entity #1 | Chains: A
Natural cytotoxicity triggering receptor 1 protein, length: 182 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 50157
95 % 2 2 42075 Flexibility: Low
Max RMSD: 1.6, Avg RMSD: 1.6
PDBFlex
90 % 2 2 31971
70 % 2 2 35507
50 % 2 2 30827
40 % 22 32 1422
30 % 27 39 1215
Entity #2 | Chains: D
Fab NKp46-4 light chain protein, length: 211 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 71586
95 % 1 1 44112
90 % 459 784 2
70 % 1509 2399 2
50 % 1888 3045 2
40 % 1888 3045 2
30 % 3839 6183 1
Entity #3 | Chains: E
Fab NKp46-4 heavy chain protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 1 71585
95 % 1 1 59017
90 % 1 1 55645
70 % 1825 2943 1
50 % 1926 3094 1
40 % 1926 3094 1
30 % 3840 6183 1
Entity #4 | Chains: H
Fab NKp46-1 heavy chain protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 1 1 71588
95 % 2 2 42448 Flexibility: Low
Max RMSD: 1.1, Avg RMSD: 1.1
PDBFlex
90 % 2 2 40497
70 % 1826 2943 1
50 % 1927 3094 1
40 % 1927 3094 1
30 % 3841 6183 1
Entity #5 | Chains: L
Fab NKp46-1 light chain protein, length: 211 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name Structural variation in cluster
100 % 2 2 57729
95 % 9 10 5390 Flexibility: Low
Max RMSD: 1.9, Avg RMSD: 0.9
PDBFlex
90 % 460 784 2
70 % 1510 2399 2
50 % 1889 3045 2
40 % 1889 3045 2
30 % 3842 6183 1

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4NZU 1 L 13PL heavy chain Fab 9606
2 5TY6 2 L VRC 315 13-1b02 Fab Light chain 9606
3 6MEE 2 B, D antibody HEPC74 Light Chain 9606
4 6BJZ 2 L 5c8 Fab Light chain 9606
5 4XCF 1 L 4E10 Fab light chain 9606
6 5X08 2 L Fab 4E10 Light chain 9606
7 4XAW 1 L 4E10 Fab light chain 9606
8 5UCB 2 L Fab Light Chain 9606
9 2VXV 2 L HUMAN IGG ABT-325 9606
10 5I8C 2 B VRC34.01 Fab light chain 9606
11 5WK2 1 L M116 LIGHT CHAIN 9606
12 4PTU 1 A Antibody pn132p2C05, light chain 9606
13 4HS6 2 A, L MRCT10.v362 Fab light chain 9606
14 4XC3 1 L 4E10 Fab light chain 9606
15 4XC1 1 L 4E10 FAB LIGHT CHAIN 9606
16 5VSI 2 L CH1/Ckappa Fab light chain 9606
17 6QCU 1 L Light chain 9606
18 6AZM 1 A, C 580 germline antibody, light chain Fragment: Fab 9606
19 4NWU 2 L APE1551 Ab Fab light chain 9606
20 3HC4 2 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN 9606
21 5CIN 2 L FAB 4E10 LIGHT CHAIN 9606
22 6CA7 1 L PCT64_13C light chain 9606
23 6MVL 3 L Antibody Fab fragment light chain 9606
24 5OB5 3 L fAb Light chain 9606
25 3QQ9 1 C, L 101F LIGHT CHAIN 10090
26 5I1K 1 L FAB LIGHT CHAIN 9606
27 4JDV 2 B, L Fab light chain NIH45-46 Germ-line Light CHAIN, IG Kappa 9606
28 5UEA 3 B, L Fab Light Chain 9606
29 5TDN 1 A, C anti-HER2 Fab Light Chain 9606
30 3QRG 1 L Fab light chain 9606
31 3NCJ 1 L Fab15 Mut8 light chain 9606
32 3HC3 2 L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
33 4NWT 1 L APE1531 Ab Fab light chain 9606
34 3NA9 1 L Fab15 light chain 9606
35 4XBE 1 L 4E10 FAB LIGHT CHAIN 9606
36 5U6A 1 A Light Chain 9606
37 4HHA 1 A Fab KE5 Fab fragment KE5 9606
38 5UEK 3 L Fab 12E Light Chain 9606
39 3NAA 1 L Fab15 Mut5 light chain 9606
40 5IK3 2 B, D 1E03 Fab fragment light chain 9606
41 6DC4 2 L Fab AM22 Light Chain 9606
42 5U3D 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
43 6BHZ 2 L, M Trastuzumab Anti-HER2 Fab Light Chain D185A 9606
44 5IT2 2 L light chain 9606
45 6MY4 2 B, L anti-VEGF-A Fab fragment bH1 light chain 9606
46 6DW2 1 A 6078 Fab light chain 9606
47 6BQB 1 L MGG4 Fab light chain 9606
48 4PUB 2 L DX-2930 LIGHT CHAIN 9606
49 6B14 2 L Light chain of Fab BL3-6S97N 10090
50 5VKD 3 L Fab light chain 9606
51 5XHG 1 A, C polypeptide(L) 10090
52 3OAZ 2 K, L Fab 2G12, light chain 9606
53 6OTC 3 L sFab H3 light chain 32630
54 6MY5 2 B, L anti-VEGF-A Fab fragment bH1 light chain 9606
55 5U4R 2 B, L VRC 315 53-1A09 Fab Light chain 9606
56 5U5F 1 A MEMAB TRASTUZUMAB FAB LIGHT CHAIN I83E 9606
57 3EO0 1 A, C GC-1008 Fab Light Chain 10090
58 5CIL 2 L FAB 4E10 LIGHT CHAIN 9606
59 6BI2 2 L, M Trastuzumab Anti-HER2 Fab Light Chain 9606
60 4JHA 2 L D25 light chain 9606
61 6B9Z 1 A Trastuzumab Fab light chain 10090
62 4PTT 1 A Antibody pn132p2C05, light chain 9606
63 5KVL 2 L Humanized 10G4 anti-Leukotriene C4 Immunoglobulin G (IgG) light chain 9606
64 5TDO 1 A, C anti-HER2 Fab Light Chain 9606
65 4DGV 2 L HCV1 Light Chain 9606
66 6PE7 2 L FAB Light chain 9606
67 5D6C 1 A, L 4497 antibody IgK (VL and CL) 9606
68 6IAS 2 L Fab NKp46-1 light chain 32630
69 6OBZ 2 B, L Light chain of FluA-20 Fab, Immunoglobulin light chain 9606
70 6GFE 2 L, M Immunoglobulin gamma-4 light chain 9606
71 3P0Y 3 L Fab DL11 light chain 9606
72 6ANA 3 L LL2 Fab Light Chain 10090
73 5IBU 1 B, L 6652 Light Chain 9606
74 6AOD 1 A FXIa Antibody FAB Light Chain 9606
75 4HH9 1 A, C Fab KE5, light chain KE5 Light chain 9606
76 6ELE 2 B, L fAB light chain 9606
77 5UR8 2 B human immunoglobulin gamma, kappa light chain 9606
78 3NAC 1 L Fab15 Mut7 light chain 9606
79 5U5M 1 A MEMAB TRASTUZUMAB, LIGHT CHAIN 9606
80 4DGY 2 L HCV1 Light Chain 9606
81 2V7N 1 A, C, E, G IMMUNOGLOBULIN LIGHT CHAIN SYNTHETIC GENE, DERIVED FROM PHAGE DISPLAY OF THE HUMAN COMBINATORIAL ANTIBODY LIBRARY (HUCAL) FAB FRAGMENT, RESIDUES 1-255 32630
82 3EO9 1 L Efalizumab Fab fragment, light chain 9606
83 6N35 1 K, L Fab 2G12 light chain 9606
84 5WUV 1 L light chain 9606
85 2HWZ 1 L Immunoglobulin Fab light chain Humanized mouse antibody MEDI-493 Anti-respiratory syncytial virus antibody 10090
86 5TDP 1 A, C anti-HER2 Fab Light Chain 9606
87 6BAH 1 A Trastuzumab Fab light chain,Immunoglobulin kappa constant 10090
88 6D0X 2 B 1210 Antibody, light chain 9606
89 1L7I 1 L chimera of Fab2C4: "humanized" murine monoclonal antibody The chimera consists of the human Ig and the original murine sequence light chain (residues 1-214) 9606
90 1JPT 1 L immunoglobulin Fab D3h44, light chain Fab fragment 9606
91 5TL5 1 L M2177 LIGHT CHAIN 10090
92 2FX7 1 L Fab 4E10 Light Chain 9606
93 6O39 1 A Antibody F2.I Fab, Light chain 9606
94 5CSZ 2 B, L GANTENERUMAB FAB FRAGMENT LIGHT CHAIN FAB 9606
95 6QKD 2 L, M, O, T FAB LIGHT CHAIN 9844
96 5XKU 2 B HNIgGA6 light chain 9606
97 6MTT 1 L Antibody VRC46.01 Fb light chain 9606
98 5I18 1 L FAB LIGHT CHAIN 9606
99 6HKG 2 B FISW84 Fab Fragment Light Chain 9606
100 3SOB 1 L antibody light chain 9606
101 6B5M 2 L CIS43 Fab Light chain 9606
102 4G6M 3 L light chain of gevokizumab antibody binding fragment 10090
103 5DR5 2 L AbD09097 Fab light chain 9606
104 4KQ3 1 L CNTO3186 light chain Fab 9606
105 2VXQ 3 L FAB L CHAIN OF THE FAB FRAGMENT COMPOSED OF THE IGE VARIABLE DOMAIN AND IGG CONSTANT DOMAIN 9606
106 4I77 2 L Lebrikizumab light chain Fab 9606
107 5WK3 1 P, R, T, V M116 LIGHT CHAIN 9606
108 4HJG 1 A Trastuzumab light chain 9606
109 3HC0 2 B, L IMMUNOGLOBULIN IGG1 FAB, HEAVY CHAIN 9606
110 3FN0 1 L Fab Z13e1 light chain 9606
111 5NYX 2 L, N, P LIGHT CHAIN fab light chain 9606
112 5IFA 2 L VRC01c-HuGL2 Fab light chain 9606
113 6ELJ 2 B, L fAB light chain 9606
114 4G6K 2 L light chain of gevokizumab antibody binding fragment 10090
115 4MAU 1 L C2244 light chain SEE REMARK 999 10090
116 1JPS 1 L immunoglobulin Fab D3H44, light chain Fab fragment 9606
117 6CBV 2 L Light Chain, Fab fragment 9606
118 5JW5 2 B, L MEDI8852 Light chain 9606
119 6DCV 1 A, L Light chain of CBTAU27.1 Fab 9606
120 3QWO 1 B, L motavizumab light chain 10090
121 4IOI 1 A Trastuzumab light chain 9606
122 6GHG 2 B, L Fab light chain 9606
123 5K8A 1 A, E, L, M humanized Fab Lite chain 10090
124 5VAG 2 B Light chain of antibody m826 9606
125 5I16 1 A, L FAB LIGHT CHAIN 9606
126 4RBP 1 K, L Fab 2G12 light chain 9606
127 4FQL 2 L monoclonal antibody CR8033 light chain Fab 9606
128 6DCW 1 L Light chain of CBTAU27.1 Fab 9606
129 5GGQ 1 L nivolumab light chain 9606
130 6B5N 2 L CIS43 Fab Light chain 9606
131 3OAY 1 K, L Fab 2G12, light chain 9606
132 6AND 3 L Pinatuzumab Fab light chain 9606
133 5K9J 2 L 56.a.09 light chain 9606
134 5JRP 1 L marberg virus monoclonal antibody MR78 Fab light chain 9606
135 5TF1 2 L O2-CC Fab Light Chain 9606
136 3TCL 2 B, L CH04 Light Chain Fab 9606
137 5F7E 2 L Fab light chain 9606
138 1T3F 1 A Huzaf antibody light chain The source is engineered human constant and framework regions with CDRs from mouse 9606
139 5FHA 2 L Antibody 114 Fab light chain 9606
140 5UMN 3 D, F Antibody C05, light chain 9606
141 4X7S 2 L Ig kappa chain C region residues 23-236 9606
142 1S3K 1 L HU3S193 Fab fragment, light chain murine complementarity determining regions grafted onto human framework and constant sequences 10090
143 5E8E 1 A IGA FAB LIGHT CHAIN 9606
144 3QPQ 1 C, E, I, L C1068 light chain 10090
145 6PHB 2 A, C 2530 Antibody Fab, Light Chain 9606
146 6MXR 2 B, L anti-VEGF-A Fab fragment bH1 light chain 9606
147 6ELL 2 B, L fAB light chain 9606
148 2HFF 1 A, L CB2 Fab, light chain 9606
149 4M7K 1 L 10H10 light chain SEE REMARK 999 10090
150 1VGE 1 L TR1.9 FAB FAB FRAGMENT OF A HUMAN IGG1 KAPPA AUTOANTIBODY 9606
151 6MXS 2 B, L anti-VEGF-A Fab fragment bH1 light chain 9606
152 5GGS 2 B, D light chain 9606
153 5I1L 1 A, L FAB LIGHT CHAIN 9606
154 5GGV 1 L light chain 9606
155 3L5X 1 L H2L6 LIGHT CHAIN 9606
156 5BJZ 3 H, L Synthetic antibody, Fab fragment, Light Chain 9606
157 2NXY 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
158 2R8S 2 L Fab light chain 10090
159 4HKZ 1 A Trastuzumab light chain 9606
160 6DB8 3 L Fab-Light chain 32630
161 6DDR 1 A Anti-MICA Fab fragment light chain clone 13A9 10090
162 6MEH 3 L antibody HEPC74 Light Chain 9606
163 3SO3 2 B A11 FAB light chain 9606
164 3OAU 2 L Fab 2G12, light chain 9606
165 5WEQ 1 A MR78 mutant light chain 9606
166 6DKJ 2 B, L Fab light chain 9606
167 4WY7 2 L Fab 4E10Light chain 9606
168 4ZYK 2 B, L AM14 light chain 9606
169 6DWA 1 A, L 4497 Fab Light Chain 9606
170 6E56 3 I, J antibody H2214 light chain, K1642 9606
171 5E94 1 A, C Antibody Fab fragment light chain 10090
172 5FB8 1 A Anti-IL-16 antibody 14.1 Fab domain Kappa Chain 10090
173 3U0W 2 L Fab Light Chain, Ig kappa chain C region chimera of Fab Light Chain from mouse, Ig kappa chain C region from human 10090
174 4HIE 1 A Fab 023.102 9606
175 3QEG 2 L Fab fragment of human anti-HIV antibody N12-i2, light chain Fab light chain 9606
176 6MED 2 B, D, I antibody HEPC3 Light Chain 9606
177 1CE1 1 L PROTEIN (CAMPATH-1H:LIGHT CHAIN) FAB 9606
178 6ME1 2 B, D VRC34.01 Fab light chain 9606
179 5ITB 2 L anti-RSV F Fab 14N4 Light chain 9606
180 5Y11 2 B MAb 4-5 light chain 9606
181 2NY2 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
182 4KMT 1 L light chain O12/KAPPA Fab 9606
183 1RHH 1 A, C Fab X5, light chain 9606
184 6U3Z 2 B, D V20_5A4 Light Chain Fab 9544
185 6CW3 2 B, D antibody light chain 9606
186 6BTJ 2 B, L Light chain of H7.5 Fab 9606
187 6BLI 2 B, E, H, K CB002.5 Fab Light Chain 9606
188 4JPI 2 B, L Putative VRC01 germline Fab light chain 9606
189 4XTR 3 D, F Antibody Light chain 32630
190 1RZ7 1 L Fab 48d light chain 9606
191 1RZG 2 B, D Fab 412d heavy chain 9606
192 5EA0 2 L Light chain of antibody 7968 Fab fragment 9606
193 3PGF 3 L SAB Light Chain 9606
194 1IQD 1 A HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN 9606
195 6DFJ 2 L anti-Zika antibody Z021, Light Chain 9606
196 2NY4 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
197 2NY3 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
198 6B9Y 1 A Trastuzumab Fab light chain 9606
199 5I1A 1 A, L CNTO388 LIGHT CHAIN 9606
200 2QQN 3 L Antibody light chain 9606
201 6MSY 1 L Fab 2G12, light chain 9606
202 3L5W 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
203 2NY1 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
204 6BAE 1 A Trastuzumab Fab light chain 10090
205 6MTP 1 B, L Antibody VRC42.04 Fab light chain 9606
206 4OGY 3 L, N DX-2930 LIGHT CHAIN 9606
207 3X3F 2 L Light chain of KMTR2 9606
208 2CMR 3 L D5 9606
209 5ZV3 3 L Light chain (kappa) of antibody CBTAU28.1 9606
210 4R4B 1 A, C, E, L FAB 2.2C LIGHT CHAIN 9606
211 5CZX 3 D, L 20358 Fab light chain 9606
212 6BI0 2 L, M Trastuzumab anti-HER2 Fab Light Chain 9606
213 3GRW 2 L Fab light chain 9606
214 6B3K 2 L Light chain of Fab BL3-6 10090
215 5I1D 1 A, L FAB LIGHT CHAIN 9606
216 5VKK 2 B, L Epratuzumab Fab Light Chain 10090
217 6AYZ 2 C, D Fab Light Chain 9606
218 2NXZ 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
219 6O3A 1 A Antibody F7.B Fab, Light chain 9606
220 1UJ3 1 A IgG Fab light chain anti-tissue-factor antibody hATR-5 Fab 9606
221 4LKC 1 A Fab fragment of PCSK9 antibody 9606
222 4KZD 2 L BL3-6 Fab antibody, light chain 10090
223 4CNI 2 B, L OLOKIZUMAB LIGHT CHAIN, FAB PORTION FAB PORTION 9606
224 4HIH 1 A, C Fab 023.102 9606
225 6O1F 4 L Light Chain hu31A.v11 9606
226 4XH2 2 B, D, F, I, K, L Fab Light Chain 9606
227 5IES 2 L VRC01cHuGL2 Fab light chain 9606
228 6OCB 2 L Light chain of FluA-20 Fab 9606
229 6RCS 2 B R5.016 light chain 9606
230 3S34 1 L 1121B Fab light chain 10090
231 6B6Z 1 A, C Apo Fab Light Chain 9606
232 6NMS 1 A, L Fab 136 anti-SIRP-alpha antibody Variable Light Chain 9606
233 6EMJ 2 B, L fAb light chain 9606
234 5W1G 2 L CR1-07 Fab light chain 9606
235 6CNR 1 L Aducanumab light chain 9606
236 6PLK 2 L, M ZIKV-116 light chain 9606
237 6OKM 2 L Fab 3C8 light chain 9606
238 3PNW 1 A, D, G, J, M, P, S, V FAB light chain 32630
239 4NRX 3 B, E, L m66 Light Chain 9606
240 3O2D 1 L ibalizumab light chain 10090
241 6DB9 3 L Fab-Light-Chain 32630
242 3HI6 3 L, Y light chain of Fab fragment of AL-57 against alpha L I domain 9606
243 5O14 3 D, L Fab 1A12 Light Chain 9606
244 4ZFG 3 L Fragment antigen binding 5A12 light chain 9606
245 5V7R 1 L CBTAU-7.1 Fab light chain 9606
246 6B5O 2 L CIS43 Fab Light chain 9606
247 2R0L 1 L antibody light chain 32630
248 1DN0 1 A, C IGM-KAPPA COLD AGGLUTININ (LIGHT CHAIN) FAB FRAGMENT 9606
249 5BK1 2 D, L Synthetic antibody, Fab fragment, Light Chain 9606
250 6N7U 2 B BDBV223 antibody light chain Fab 9606
251 3GIZ 1 L Fab fragment of anti-CD20 antibody Ofatumumab, light chain 9606
252 6N32 1 L, M Fab 2G12 light chain 9606
253 3Q1S 1 L Z13e1 Fab light chain 9606
254 6TYB 4 L NEUTRALIZING ANTIBODY ITS90.03 FAB LIGHT CHAIN 9544
255 6DWC 1 A, L 4497 Fab Light Chain 9606
256 5VR9 2 B, L CH1/Ckappa Fab light chain 9606
257 5VZ1 1 A, C Apo Antibody Fab Light Chain 9606
258 5OD8 2 B B2 Fab fragment - Light chain 9606
259 3KR3 3 L antibody-Fab (light chain) 9606
260 5DK3 1 A, F Light Chain 9606
261 6DZN 1 L Antibody ADI-15878, light chain 9606
262 2NY0 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
263 5GGU 2 B, L light chain 9606
264 5KW9 3 L IgA Light chain 9606
265 1YYM 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
266 5W2B 2 L Fab Light Chain 9606
267 4QXG 2 L Fab, light chain, IgG1 Fab, light chain 9606
268 6E4X 2 Y S5V2-29 light chain 9606
269 2I5Y 2 L, Q Antibody 17B Light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
270 2FX9 1 L, M Fab 4E10 Light Chain 9606
271 3C08 1 L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
272 6AXL 1 B, C Fab317 light chains 9606
273 1BZ7 1 A PROTEIN (ANTIBODY R24 (LIGHT CHAIN)) FAB 10090
274 1TZG 1 L, M Fab 4E10 light chain 9606
275 6HIG 2 L Light Chain 10090
276 3W9D 2 B, D Antibody Fab light chain 9606
277 6CXG 1 K, L anti-HIV-1 Fab 2G12 light chain 9606
278 6CO3 1 L Fab light chain 9606
279 4NRZ 2 B, L M66.6 LIGHT CHAIN Fab Light Chain 9606
280 3BN9 2 C, E E2 Fab Light Chain 9606
281 6EYN 1 A, C, L 8D6 Fab light chain 8D6 Fab light chain 9606
282 4HWE 2 L Fab light chain light chain 9606
283 6DZR 2 L h38c2 light chain 9606
284 6DF0 1 L 4G10-4D5 Antibody Light chain 32630
285 6U9U 2 L GM9_TH8seq732127 FAB light chain 9606
286 6DF1 1 L Anti-phosphotyrosine antibody 4G10-4D5 heavy chain 9606
287 5TZ2 2 L C47B222 Fab Light Chain 9606
288 3L95 1 A, L anti-NRR1 fab fragment light chain 9606
289 4OGX 3 L DX-2930 LIGHT CHAIN 9606
290 3W9E 3 B Antibody Fab light chain 9606
291 5TFS 2 L 02-K Fab Light chain 9606
292 4KZE 2 L BL3-6 Fab antibody, light chain 10090
293 5WT9 2 L Light Chain of Nivolumab 9606
294 4HIJ 1 A, C Fab 023.102 light chain 9606
295 6MU3 1 K, L Fab 2G12, light chain 9606
296 4XVU 3 D, F, J, L Antibody light chain 32630
297 5B71 1 A, C SKY59 Fab light chain 9606
298 6BF4 3 C, L VRC-PG05 Fab light chain 9606
299 6FG1 2 D LIGHT CHAIN OF FAB NAA32 9606
300 3EYF 1 A, C 8f9 Fab 9606
301 3NAB 1 L Fab15 Mut6 light chain 9606
302 4Q9Q 2 L Fab BL3-6, LIGHT CHAIN 10090
303 5I1C 1 L FAB LIGHT CHAIN 9606
304 5WNA 2 D, L mAb 3D3 Fab light chain 9606
305 1RZ8 1 A, C Fab 17b light chain 9606
306 4WV1 3 A, D Fab light chain 9606
307 5EII 2 B, L Fab Light Chain 9606
308 5KZP 2 I, J, K, L HCV1-C1 Antibody Fab Light Chain 9606
309 4FNL 2 L, M Antibody C05, Light Chain 9606
310 4UB0 2 L IgG1, light chain 9606
311 1FVD 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
312 1BJ1 1 J, L Fab fragment, light chain HUMANIZED VERSION OF A MONOCLONAL MURINE ANTI-VEGF ANTIBODY 10090
313 5I1H 1 L FAB LIGHT CHAIN 9606
314 2FX8 1 L, M, N, O Fab 4E10 Light Chain 9606
315 6BFT 1 B, L Avastin Light Chain Fab fragment mutant 9606
316 6DFI 2 L anti-Zika antibody Z021, Light Chain 9606
317 5I1J 1 L FAB LIGHT CHAIN 9606
318 3IDX 3 L Fab b13 light chain 9606
319 5CIP 2 B, L FAB 4E10 LIGHT CHAIN 9606
320 5IF0 2 B, L VRC01c-HuGL2 Fab light chain 9606
321 4K94 1 L Fab19 heavy chain 9606
322 5K9Q 4 I, K, L, T, V, Y 16.a.26 Light chain 9606
323 6B5L 2 L CIS43 Fab Light Chain 9606
324 1I7Z 1 A, C CHIMERA OF IG KAPPA CHAIN: HUMAN CONSTANT REGION AND MOUSE VARIABLE REGION THE CHIMERA CONSISTS OF RESIDUES 1-108 OF MOUSE PORTION AND 109-214 OF HUMAN PORTION OF IG KAPPA CHAIN. 10090
325 4JPK 2 L Putative VRC01 germline precursor Fab light chain 9606
326 5XAJ 2 B, L FabHM14c10 light chain 9606
327 4ZD3 2 L 679-14-14E06 Fab fragment light chain 9606
328 5VEB 2 B, L anti-CDH6 Fab light chain 9606
329 6N81 2 D, L A1227 Fab light chain 9606
330 3X3G 2 L Light chain of KMTR2 9606
331 5E08 2 L Fab Light Chain 9606
332 6AZ2 3 E, F Fab Light Chain 9606
333 1CZ8 2 L, X LIGHT CHAIN OF NEUTRALIZING ANTIBODY MUTATED FORM OF A HUMANIZED MURINE ANTIBODY LIGHT CHAIN 10090
334 5IBT 2 L UCA Light Chain 9606
335 6CA6 1 A, L PCT64_35S light chain 9606
336 4XAK 3 E, L Light chain of neutralizing antibody m336 9606
337 5JQ6 3 L Tefibazumab FAB FRAGMENT LIGHT CHAIN 10090
338 6DF2 1 A, L Anti-phosphotyrosine antibody c310-4D5 heavy chain 32630
339 3HR5 1 A, L, P, Q Fab h47H4 light chain 10090
340 5XRQ 2 B, L Fab H3v-47 light chain 9606
341 6AL4 1 A, C, E B43 LIGHT CHAIN 9606
342 2I60 2 L, Q ANTIBODY 17B LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
343 4NGH 1 L FAB LIGHT CHAIN 9606
344 4EDW 2 L tanezumab Fab light chain 9606
345 1FVE 1 A, C IGG1-KAPPA 4D5 FAB (LIGHT CHAIN) 9606
346 2NY5 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
347 4NM4 1 L, M Antibody CR8043, Light Chain 9606
348 2H9G 1 A, L Fab BdF1, light chain Fab fragment 9606
349 4G7V 2 L fragment antibody light chain 9606
350 4HFW 1 A, L 6-26 Fab Light chain 9606
351 3L7E 1 A, L C836 LIGHT CHAIN CHIMERIC MOLECULE OF MOUSE VARIABLE DOMAIN AND HUMAN CONSTANT DOMAIN 10090
352 6NMU 1 A, L Fab 115 anti-SIRP-alpha antibody Variable Light Chain 9606
353 2XRA 3 L HK20, HUMAN MONOCLONAL ANTIBODY LIGHT CHAIN 9606
354 4LIQ 3 L Fab fragment RG7155 light chain Humanized Version of a monoclonal murine. 10090
355 5JO4 2 B D80 Fab Light Chain 9606
356 5JO4 4 D G6 Fab Light Chain 9606
357 3INU 2 L, N KZ52 antibody fragment light chain 9606
358 5EU7 3 C, D FAB light chain 9606
359 1DFB 1 L IGG1-KAPPA 3D6 FAB (LIGHT CHAIN) 9606
360 5X8M 3 C durvalumab light chain 9606
361 1RZJ 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
362 4HII 1 A, C Fab 023.102 light chain 9606
363 1AD0 1 A, C ANTIBODY A5B7 (LIGHT CHAIN) FAB FRAGMENT 9606
364 4DN3 1 L CNTO888 LIGHT CHAIN 9606
365 4U6V 2 L, M Fab, antigen binding fragment, light chain 9606
366 5WNB 2 L, M mAb 3D3 Fab light chain 9606
367 2XA8 2 L OMALIZUMAB LIGHT CHAIN 9606
368 3EYV 1 A, L hu3S193 Fab, light chain 10090
369 1GC1 3 L ANTIBODY 17B MONOCLONAL ANTIBODY 17B BINDS TO A CD4-INDUCED SITE ON GP120 ANTIGEN-BINDING FRAGMENT, FAB 9606
370 6Q20 2 L 1E01 Fab kappa light chain 9606
371 5IJK 3 C, D 1E03 Fab fragment light chain 9606
372 3BDY 2 L Fab Fragment -Light Chain 9606
373 5I8E 2 B, D VRC34.01 Fab light chain 9606
374 3FZU 1 D, L immunoglobulin IgG1 Fab, light chain 9606
375 1G9M 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
376 5UIX 2 L DH576 Fab light chain 9606
377 3K2U 4 L Antibody, Fab fragment, Light Chain 9606
378 6MFT 2 B, L Light chain glVRC01 9606
379 4HWB 3 L Fab light chain 9606
380 5VSH 2 B, D, F, L CH1/Clambda Fab light chain 9606
381 1PG7 2 L, M humanized antibody D3H44 antigen-binding fragment 10090
382 2HFG 1 L CB3s Fab light chain (kappa) 9606
383 3GKW 2 L Light chain of the antibody Nimotuzumab 9606
384 3JWD 3 L, O FAB 48D LIGHT CHAIN 9606
385 5ZIA 2 B, E, I, L, M, P Light chain (kappa) of CBTAU-24.1 antibody 9606
386 4JQI 3 L Fab30 light chain 10090
387 6B0H 3 A, C 1262 antibody, light chain 9606
388 6U8C 2 C, L Antibody light chain Fab 9606
389 3SKJ 1 L, M Antibody, light chain 9606
390 3U30 2 B, E Light chain Fab 9606
391 6B0A 2 L 1269 antibody, light chain 9606
392 6MFJ 2 B, L DH677.3 Fab light chain 9606
393 5HYS 2 B, D, F, L Uncharacterized protein 9606
394 3L7F 1 A, D, L H2L6 LIGHT CHAIN 9606
395 5I15 1 L FAB LIGHT CHAIN 9606
396 2FJF 1 A, C, E, G, J, L, M, O, Q, S, U, W Light Chain of a VEGF binding Antibody 9606
397 5I1E 1 L FAB LIGHT CHAIN 9606
398 2NYY 2 C CR1 monoclonal antibody light chain 9606
399 2GCY 1 A huC25 fab fragment light chain 10090
400 4JLR 2 B, L Motavizumab Fab light chain 9606
401 2QQK 3 L Antibody Light Chain 9606
402 4J1U 1 A, C, E antibody 93F3 Light chain 10090
403 4RRP 1 A, B, C, D, E, F Fab antibody, light chain 9606
404 5SX5 1 K, L Panitumumab Fab Light Chain 9606
405 5JQD 1 A, B D80 Fab Fragment Light Chain 9606
406 6JC2 2 L ipilimumab fab light chain 9606
407 4XGZ 2 B, D, F, I, K, L, N, P, R, T, V, X FAB LIGHT CHAIN 9606
408 1N8Z 1 A Herceptin Fab (antibody) - light chain 10090
409 4OAW 1 A, C Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 2158 9606
410 4KXZ 3 I, L, M, P GC1008 Light Chain 9606
411 5BK2 3 D, L sAB Light Chain 9606
412 1TZH 2 A, L Fab YADS1 Light Chain 10090
413 5O1R 3 L, M Uncharacterized protein 9606
414 6CMI 2 C m102.3 light chain 9606
415 4JZJ 3 B, L Fab Light Chain 10090
416 5BO1 3 L, M Fab light chain 9606
417 6FOE 2 B, L Fab BaxB01 light chain engineered Fab light chain binds oxidized macrophage migration inhibitory factor (MIF) 9606
418 4M6O 1 L CNTO7309 light chain 9606
419 5LSP 3 L, T 107_A07 Fab light chain 9606
420 6MWN 3 D, L Fab HAVx Light Chain 9606
421 4DVR 2 L Fab 48d Light chain 9606
422 3EYQ 1 C M2J5 Fab 9606
423 6PI7 2 B, E Uncharacterized protein 9606
424 5BK3 1 B, D, F, L 580 Antibody, light chain 9606
425 6HXW 3 D, L IPH53 light chain 32630
426 4XWO 3 D, F, J, L, P, R, V, X Antibody light chain 32630
427 4ZFF 2 B, L Fragment antigen binding (Fab) 5A12 Light chain 9606
428 3HI5 2 L light chain of Fab fragment of AL-57 against alpha L I domain 9606
429 6BGT 2 A Herceptin light chain mutant 9606
430 4XBG 1 B, D, F, I, K, L 4E10 Fab light chain 9606
431 1YYL 2 L, Q antibody 17b light chain ANTIGEN-BINDING FRAGMENT, FAB 9606
432 6MTQ 1 L Antibody VRC42.N1 Fab light chain 9606
433 2NY6 3 C ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
434 5FUZ 2 L 645 FAB, LIGHT CHAIN 9606
435 3DVG 1 A Human IgG1 fab fragment light chain 9606
436 4HS8 3 L antibody hu5B3.v2 Fab light chain 9606
437 2AGJ 1 L Yvo Fab, Light Chain 9606
438 3EYO 1 A, C 8f9 Fab 9606
439 1B6D 1 A, B IMMUNOGLOBULIN IMMUNOGLOBULIN LIGHT-CHAIN DIMER 9606
440 5BZD 1 A, C 5G8 HIV Antibody light chain 9606
441 3NFS 1 L Heavy chain of Fab fragment of daclizumab 9606
442 3B2U 1 D, G, K, L, O, R, U, X IMC-11F8 Fab Light chain 9606
443 4DN4 1 L CNTO888 LIGHT CHAIN 9606
444 2FGW 1 L H52 FAB (LIGHT CHAIN) 9606
445 1B2W 1 L PROTEIN (ANTIBODY (LIGHT CHAIN)) V DOMAIN AND C DOMAIN 10090
446 6MHR 2 B, E Urelumab Fab kappa chain 9606
447 2FJG 2 A, L Fab light chain 9606
448 4DKF 3 L, M FAb2 Light Chain 9606
449 5TLK 1 A, E M2177 LIGHT CHAIN 10090
450 5TLK 3 C, G H2191 LIGHT CHAIN 10090
451 6OGX 2 D Fab1 Light Chain 9606
452 6OGX 5 L Fab2 light chain 9606
453 1HEZ 1 A, C KAPPA LIGHT CHAIN OF IG 1-214 9606
454 6MEJ 5 L antibody HEPC3 Light Chain 9606
455 1IT9 1 L HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN FAB FRAGMENT 10090
456 3EFD 1 L FabL 10090
457 4LF3 1 A, D Fab heavy chain 10090
458 6MTO 1 L Antibody VRC42.01 Fab light chain 9606
459 6IAP 2 D Fab NKp46-4 light chain 32630
460 6IAP 5 L Fab NKp46-1 light chain 32630
461 5K59 4 F, L Fab light chain 9606
462 6MUB 1 K, L Fab 2G12, light chain 9606
463 6BFQ 2 B, D, F, L Fab Light Chain 9606
464 5WI9 2 E, L 39F7 Fab light chain 9606
465 6BKC 2 L Fab AR3B light chain 9606
466 5KN5 2 B, E Epiregulin Antibody LY3016859 Fab Light Chain 9606
467 6O3B 1 A, E Antibody Fab F6, Light chain 9606
468 4XCN 1 B, D, F, I, K, L 4E10 Fab light chain 9606
469 5F3H 2 B, D, F, H humanized RK35 antibody light chain 10090
470 4LEO 2 B RG7116 Fab light chain 10090
471 4G7Y 2 L Fragment antibody light chain 9606
472 6B3S 3 D, G, K, L Necitumumab Fab Light chain 9606
473 4PY8 4 J antibody 3.1 light chain Fab 9606
474 3SDY 4 L Antibody CR8020, Light Chain 9606
475 3DVN 1 A, L Human IgG1 fab fragment light chain 9606
476 3IXT 1 B, L Motavizumab Fab light chain 10090
477 6FAX 1 L Lob 7.4 light chain 9606
478 4NP4 3 L, M bezlotoxumab light chain 9606
479 3UC0 3 L, M Light chain, monoclonal antibody 5H2 Fab 9598
480 4XCE 1 B, D, L 4E10 Fab light chain 9606
481 1BBJ 1 A, L IGG4-KAPPA B72.3 FAB (LIGHT CHAIN) 10090
482 6U85 2 L antibody Fab Light chain 9606
483 5I1I 1 L FAB LIGHT CHAIN 9606
484 4NNP 3 L, Y Light chain of antagonistic fab fragment 9606
485 4ERS 1 L Fab light chain 9606
486 1DEE 1 A, C, E IGM RF 2A2 FAB LIGHT CHAIN 9606
487 4MWF 2 B, L Fab AR3C light chain 9606
488 2WUC 5 L FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
489 3SQO 3 L J16 Light chain 9606
490 4K3J 4 L Onartuzumab Fab light chain 10090
491 6PE8 2 B, L FAB Light chain 9606
492 6N8D 2 B, E A1431 Fab light chain 9606
493 6CYF 2 C, E, L, T IgG1 antibody, kappa light chain 9606
494 4PS4 1 L M1295 LIGHT CHAIN 9606
495 5GGT 3 L IGK@ protein 9606
496 6OL5 4 L iglb12 Light Chain 9606
497 6MNF 1 K, L Fab 2G12, light chain 9606
498 3HI1 2 A, L F105 Light Chain 9606
499 4PY7 2 B, J antibody 3.1 light chain Fab 9606
500 6AL5 2 L B43 LIGHT CHAIN 9606
501 4K8R 3 C Fab1, light chain 9606
502 1RZK 3 L ANTIBODY 17B, LIGHT CHAIN FAB 9606
503 6CMG 2 B m102.3 light chain 9606
504 6HHC 1 L FXIA ANTIBODY FAB LIGHT CHAIN 9606
505 6U38 3 L Fab Light Chain 9606
506 1G9N 3 L ANTIBODY 17B, LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
507 6ML8 4 L C05 antibody Fab light chain 9606
508 1TZI 1 A Fab YADS2 Light Chain 10090
509 1QLR 1 A, C IGM KAPPA CHAIN V-III (KAU COLD AGGLUTININ) FAB FRAGMENT 9606
510 4KUZ 1 L antibody 4A5 light chain Fab (mouse variable domain, human constant domain) 10090
511 4X7T 2 B, L Omalizumab-Fab Light chain 9606
512 4YK4 1 B, Y 641 I-9 VLCL antibody 9606
513 2QSC 1 L Fab F425-B4e8, Light chain Light chain 9606
514 1MHP 3 L, Y FAB FRAGMENT, light chain 10090
515 4N9G 2 B, F, L, N Antibody 17HD9, Light Chain 9544
516 5XMH 2 C, L YES8c light chain 9606
517 6MEI 3 L antibody HEPC3 Light Chain 9606
518 3R1G 3 L FAB of YW412.8.31 antibody light chain 9606
519 5I1G 1 L FAB LIGHT CHAIN 9606
520 2QQL 3 L Antibody Light Chain 9606
521 4XCC 1 L 4E10 Fab light chain 9606
522 4MXV 2 E, L, X anti-Lymphotoxin alpha antibody light chain Fab 9606
523 5SX4 1 I, L Panitumumab Fab Light Chain 9606
524 3WD5 2 L Adalimumab Light Chain 9606
525 5Y2L 4 J a group 2 HA binding antibody AF4H1K1 Fab light chain 9606
526 4NHC 1 L FAB LIGHT CHAIN 9606
527 3EOA 1 A, L Efalizumab Fab fragment, light chain 9606
528 6U36 3 L Fab Light Chain 9606
529 5GZO 3 D, L Antibody light chain 9606
530 2WUB 4 L, Q FAB FRAGMENT FAB40.DELTATRP LIGHT CHAIN 9606
531 5GMQ 3 C MCA1 light chain 9606
532 6CA9 1 A, C PCT64_LMCA Fab light chain 9606
533 4KY1 1 L IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN muHP1/2 CDRs + human kappa B3 germline VL framework 9606
534 5TRU 1 L, l Ipilimumab Fab light chain 9606
535 4FP8 3 L, M, N, O Antibody C05, light chain 9606
536 6BKB 3 L Fab AR3A light chain 9606
537 6R2S 1 A Antibody DB9 light chain 9606
538 6I8S 3 I, J, K, L LIGHT CHAIN OF FAB FRAGMENT FROM AN PAI-1 ANTIBODY FAB FRAGMENT 9606
539 4YPG 1 A, L Sifalimumab light chain 9606
540 6NMR 1 B, G, K, L Fab 119 anti-SIRP-alpha antibody Variable Light Chain 9606
541 6CW2 4 B antibody light chain 9606
542 3BE1 3 L Fab Fragment-Light Chain 9606
543 2FJH 2 A, L Fab fragment light chain 9606
544 5XEZ 3 D, L Antibody, mAb1, light chain 9606
545 4K9E 1 L light chain 10090
546 6MEF 2 L antibody AR3C Light Chain 9606
547 3P0V 1 L, M Fab DL11 light chain 9606
548 2OQJ 1 A, D, G, J Fab 2G12 light chain 9606
549 6OEL 5 L engineered Fab light chain 9606
550 5VIG 2 B, L Fab light chain 9606
551 4UTA 3 L, M BROADLY NEUTRALIZING HUMAN ANTIBODY EDE1 C8 LIGHT CHAIN FAB FRAGMENT 9606
552 3HMX 3 L USTEKINUMAB FAB LIGHT CHAIN 9606
553 6I04 3 D, L Fab light chain 9606
554 4KVN 3 L Human IgG Light Chain 9606
555 4KUC 2 D, E mAb6c2 fab-Heavy chain 10090
556 5VYF 1 A, L Antibody light chain 10090
557 4K7P 1 X antibody rhumAb6 Fab fragment light chain Fab rhumAb6 9606
558 4K7P 4 L antibody 10C4 Fab fragment light chain 10090
559 5WUX 2 B, D, L light 9606
560 3OB0 1 K, L Fab 2G12, light chain Fab 9606
561 6MFP 4 D, L DH677.3 Fab light chain 9606
562 1T04 1 A, C Huzaf Antibody Light Chain The source is engineered human constant and framework regions with CDRs from mouse. 9606
563 5VQM 2 C, L PA41 FAB LIGHT CHAIN 9606
564 6GK7 1 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-27.1(S31Y,T100I) FAB ANTIBODY FRAGMENT 9606
565 3ZTN 4 L FI6V3 ANTIBODY LIGHT CHAIN 9606
566 5DUM 2 L 65C6 Light Chain 9606
567 4I18 1 B, L antibody light chain Fab 10090
568 4Q9R 2 L Fab BL3-6, LIGHT CHAIN 10090
569 3KYM 1 A, C, E, G, I, K, M, O Light Chain Li33 IgG2 9606
570 3IDY 3 C, L Fab b13 light chain 9606
571 4OQT 2 L Light Chain of Li81 Fab, kappa 3 9606
572 3IVK 1 B, L Fab light chain man 10090
573 3KYK 2 L Light Chain Li33 IgG1 9606
574 5TGB 2 B, L 02-CB Fab Light Chain 9606
575 5I19 1 L FAB LIGHT CHAIN 9606
576 5TH9 1 L, M, N GS-5745 Fab light chain 9986
577 5JOF 2 B, D, F, L VRC03 gLV light chain 9606
578 6OKN 2 B, D Fab 1A7 light chain 9606
579 6OC3 2 B, D Light chain of FluA-20 Fab 9606
580 6NZ7 4 I, L 429 B01 FAB light chain 9606
581 5X8L 2 K, L, M, N, O atezolizumab light chain 9606
582 5UDC 2 C, G, L MEDI8897 Fab Light Chain 9606
583 6GK8 2 L HUMAN FAB ANTIBODY FRAGMENT OF CBTAU-28.1(S32R;E35K) FAB ANTIBODY FRAGMENT 9606
584 5FEC 2 B, L germline 3BNC60 light chain 9606
585 1RZI 1 A, C, E, G, I, K, M, O Fab 47e light chain 9606
586 2R56 2 L, M IgE Fab Fragment, light chain 9606
587 1ZA6 1 A, C, E, G IGG Light chain 9606
588 4YWG 1 L, M Light chain of anti-HIV-1 gp120 V1V2 antibody 830A 9606
589 4ZS6 1 D, L fab Light Chain 9606
590 4Z5R 2 A, J, L, P, R, T, V, Y anti-IFN-a antibody rontalizumab light chain 9606
591 6APB 3 L ADI-14359 Fab Light Chain 9606
592 1U6A 1 L F105 LIGHT CHAIN ANTIGEN-BINDING FRAGMENT, FAB 9606
593 4XBP 1 B, D, F, L 4E10 FAB LIGHT CHAIN 9606
594 5K9K 2 B, L 56.a.09 Light chain 9606
595 5BZW 1 A 2B3 HIV Antibody light chain EIVLTQSPGTLSLSPGERATLSCRASQSVSAKNLAWYQQKPGQTPRLLMYGVSLRNTGVP DRFSGSGSGTDFTLTISRLEPEDSAVYFCQQYGTSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 9606
596 5W4L 6 C, E Antibody N12-i3 light chain 9606
597 5CD3 2 B, D, F, H DRVIA7 Light Chain 9606
598 6D01 2 B, D, F, H 1210 Antibody, Light chain 9606
599 6Q23 3 F, I, K, L 1G01 Fab kappa light chain 9606
600 5CZV 3 L Fab 20350 light chain 9606
601 5XF1 3 D, L Antibody mAb1 Light chain 9606
602 4P59 3 L MOR09825 Fab fragment light chain 9606
603 5XXY 2 L light chain of atezolizumab fab 9606
604 5CJO 3 L FAB light chain 10090
605 4LMQ 3 I, L Stromal cell-derived factor 1 9606
606 3N85 2 L Fab37 Light Chain 9606
607 3G6J 3 E, G Fab light chain 9606
608 5GJT 3 L light chain of human neutralizing antibody 3E1 light chain of neutralizing antibody 3E1 9606
609 6MH2 1 A, C Herceptin Fab arm light chain 9606
610 6K7O 3 C, E, G, L h128-3 Fab light chain 9606
611 3HMW 1 L USTEKINUMAB FAB LIGHT CHAIN 9606
612 6B9J 3 B, L Fab vv138 Light chain 9606
613 5O4G 2 A MF3958 FAB light chain 9606
614 6PE9 2 B, D, F, L, M FAB Light chain 9606
615 2QAD 3 C, G anti-HIV-1 antibody 412d light chain FAB, ANTIGEN-BINDING FRAGMENT 9606
616 4DKE 3 L, M FAb1.1 Light Chain 9606
617 5I17 1 A, L FAB LIGHT CHAIN 9606
618 5VIC 2 L Fab light chain 9606
619 6MEK 3 D, L HEPC3 Light Chain 9606
620 3NFP 2 B, L Light chain of Fab fragment of daclizumab 9606
621 1BEY 1 L CAMPATH-1H ANTIBODY FAB FRAGMENT 9606
622 4R8W 4 L Light chain of neutralizing antibody CT149 9606
623 5TPN 3 L hRSV0 light chain 9606
624 5GJS 3 L light chain of human neutralizing antibody 3E1 9606
625 6Q1Z 2 C, L 1G04 Fab kappa light chain 9606
626 1I9R 3 L, M, Y IMMUNOGLOBULIN L 9606
627 4NRY 1 B, L m66 Heavy Chain 9606
628 6OE4 2 C, F CR9501 Fab Light Chain 9606
629 6N2X 1 K, L Fab 2G12 light chain 9606
630 3S37 1 L 1121B Fab light chain 10090
631 5XHF 1 A, C polypeptide (L chain) 10090
632 5VL7 4 L Fab33 light chain 9606
633 1PKQ 1 A, F (8-18C5) chimeric Fab, light chain 10090
634 6P8N 3 D, L P-p1f1 Light Chain 10090
635 5JXE 2 C, F Pembrolizumab Fab light chain 9606
636 5W42 4 L Fab H3v-47 light chain 9606
637 4JM2 3 C 17b Light chain Fab 9606
638 6DEZ 1 A, L Anti-phosphotyrosine antibody PY20-4D5 light chain 32630
639 1S78 2 C, E Pertuzumab Fab light chain 10090
640 4NYL 1 B, D, F, L Adalimumab Light Chain 9606
641 5D1Z 1 A, H Y10 Light Chain 9606
642 5D1Z 3 C, E D4-10 Light Chain 9606
643 5GGR 2 B, L light chain 9606
644 5IBL 4 D, L 6639 Light Chain 9606
645 4XHJ 3 C, G Fab-RC light chain 9606
646 5O4O 1 A MF3178 FAB light chain 9606
647 5HJ3 4 B, F, J, N KZ52 Antibody Fragment 9606
648 4N90 3 E, G, I Fab light chain 9606
649 4UBD 4 D, H, L, P, T, X monoclonal antibody L chain 9606
650 5D1Q 1 A D2-06 Light Chain 9606
651 5D1Q 4 D P5 Light Chain 9606
652 1ZA3 1 A, L Fab-YSd1 light chain Fab light chain 9606
653 6DC5 3 C, F, I Fab AM22 light chain 9606
654 3UAJ 3 D, L Light chain, monoclonal antibody 5H2 Fab 9598
655 3EO1 1 A, D, G, J GC-1008 Fab Light Chain 10090
656 3C09 1 B, L Matuzumab Fab Light chain Human/mouse chimeric derivative of mouse monoclonal antibody 425 10090
657 5XHV 3 L, Q S40 light chain 9606
658 5UWE 2 L HUMAN ANTI-HIV ANTIBODY N12-I2 Fab LIGHT CHAIN 9606
659 4IOF 3 D, F Fab-bound IDE, light chain 10090
660 5FUO 3 L FAB LIGHT CHAIN 9606
661 5FEH 1 A, C, E PCT64_26 Fab light chain 9606
662 4JHW 2 L D25 light chain 9606
663 4HG4 4 K, M, O, Q, S, U, W, Y, z Fab 2G1 light chain 9606
664 6CXL 1 K, L anti-HIV-1 Fab 2G12 light chain 9606
665 3ZTJ 4 H, J, L FI6V3 ANTIBODY LIGHT CHAIN 9606
666 4M1C 3 D, F Fab-bound IDE, light chain 9606
667 5UQY 3 C, G, K, O MR78 Fab light chain 9606
668 6D0U 3 D, F, I, L Antibody C05, light chain 9606
669 2JIX 1 A, G, L ABT-007 FAB FRAGMENT 9606
670 3ULV 2 L Fab15 light chain 9606
671 3ULV 6 E Fab1068 light chain 9606
672 5UG0 3 C 2897 light chain 9606
673 4M7L 2 L 10H10 light chain SEE REMARK 999 10090
674 6OUS 4 N, P, R, T, V, X RB1 Fab Light chain 9606
675 6P8M 3 L P-p3b3 Light Chain 10090
676 4MXW 5 L, V anti-Lymphotoxin alpha antibody light chain Fab 9606
677 6P91 3 L Fab 18.5C Antibody light chain 9606
678 6N7J 2 B, L BDBV223 antibody light chain Fab 9606
679 5UOE 3 L, N, Q, T, W FAB light chain 9606
680 5VL3 3 B, D, F, L Epratuzumab Fab Light Chain 10090
681 5D1X 4 D P5 Light Chain 9606
682 5JW3 4 L MEDI8852 light chain 9606
683 5WKO 2 B, D, F, H, J, L Antibody 27F3 light chain 9606
684 5UMI 2 B, L PA50 Fab Light chain 9606
685 6BKD 3 L Fab AR3D light chain 9606
686 6D11 2 B, D 1450 Antibody, Light chain 9606
687 6APD 3 E, G, I AM22 Fab Light Chain,Uncharacterized protein 9606
688 2NZ9 2 C, E AR2 monoclonal antibody light chain 9606
689 3S36 1 L 1121B light chain 10090
690 5CWS 1 A, G sAB-158 Fab Light Chain 9606
691 5I5K 3 L, Y Eculizumab light chain (variable domain) 9606
692 2R0K 2 L antibody light chain of Fab58 9606
693 3CSY 2 B, D, F, H Fab KZ52 light chain light chain 9606
694 5C8J 2 B, D, F, H Antibody fragment, light chain OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG. ANTIBODY FRAGMENT; THE CDRS ARE COMPLETELY SYNTHETIC 9606
695 4R4F 2 L Antibody 2.2c LIGHT CHAIN 9606
696 4G80 3 B, D, F, H fragment antibody light chain 9606
697 3JWO 3 L FAB 48D LIGHT CHAIN 9606
698 5CD5 3 D DRVIA7 Fab Light Chain 9606
699 5Y2M 4 J, L a group 2 HA binding antibody AF4H1K1 Fab light chain 9606
700 3P11 2 L Fab DL11 light chain 9606
701 6EYO 3 L, M 8D6 Fab light chain 8D6 Fab light chain 9606
702 3F12 1 A, C M2J1 Fab 9606
703 3B2V 1 L IMC-11F8 FAB Light chain 9606
704 5IGX 3 L germline NIH45-46 light chain 9606
705 3ULU 2 L Fab15 light chain 9606
706 3ULU 6 E Fab1068 light chain 9606
707 5KAQ 3 G, L, R ANTIBODY 31.A.83 FAB LIGHT CHAIN 9606
708 5W1K 1 A, F, K, S CR1-28 Fab light chain 9606
709 5W1K 3 C, H, M, N CR1-10 Fab light chain 9606
710 4XI5 3 C Fab-94 light chain 9606
711 5WOB 4 J, L, N, P, R, T, V, X IDE-bound Fab light chain 60742
712 3EOB 1 A, L Efalizumab Fab fragment, light chain 9606
713 6EAY 1 L CA45 light chain 9541
714 5G64 3 L, M FAB FRAGMENT LIGHT CHAIN, RESIDUES 1-218 9606
715 4NM8 3 L, M, N Antibody CR8043, Light Chain 9606
716 5W1M 1 A, C, E, G CR1-07 Fab light chain 9606
717 4XCY 1 B, D, F, I, K, L 4E10 Fab light chain 9606
718 5TLJ 1 A, E M2177 LIGHT CHAIN 10090
719 5TLJ 3 C, G M2191 LIGHT CHAIN 10090
720 6RCV 4 D, I R5.016 light chain 9606
721 5JW4 4 N, P, T, V, X MEDI8852 light chain 9606
722 5JW4 6 R MEDI8852 light chain 9606
723 2QR0 1 A, E, G, K, M, Q, S, W Fab-Fragment Light Chain 9606
724 5UDD 3 P, Q, R, S, T, U MEDI8897 Fab Light Chain 9606
725 5J3D 2 B, D, L 14N4 light chain 9606
726 2B4C 3 L anti-HIV-1 gp120 immunoglobulin X5 light chain 9606
727 5ESZ 2 B, L CH04 Light Chain 9606
728 4R4N 3 D, G, K, L, O, R, U, X Antibody 2.2c LIGHT CHAIN 9606
729 3EFF 1 A, C FAB 10090
730 3PJS 1 A, C FAB light chain 10090
731 6OE5 3 C Motavizumab Fab Light Chain 10090
732 6OE5 5 L CR9501 Fab Light Chain 9606
733 6MAM 2 B, D, F ADI-15946 Fab Light Chain 9606
734 5O7P 2 A MF3178 FAB light chain 9606
735 4ZYP 3 L, M, O Motavizumab antibody light chain 10090
736 4ZYP 5 E, G, I AM14 antibody light chain 9606
737 6B3M 4 D, J, N, P, U, W 70-1F02 Fab Light Chain 9606
738 6RCU 4 D R5.016 light chain 9606
739 5DWU 4 L Fab - Light Chain 9606
740 5V2A 3 L Light chain (kappa) of H7.167 antibody Fab 9606
741 6EA7 4 L, N, R ADI-15878 Fab Light Chain 9606
742 5I8H 5 F, H VRC34.01 Fab light chain 9606
743 4RQS 2 C 17b Fab Light Chain 9606
744 4FQR 4 b, d, f, h, j, l, n, p, r, t, v, x Broadly neutralizing antibody C05, light chain 9606
745 4R4H 3 L Antibody 2.2c, Light chain 9606
746 6EA5 4 L, N, R ADI-15878 Fab Light Chain 9606
747 5FHC 5 L Antibody 114 Fab light chain 9606
748 4XMN 6 L Antibody 87 light chain 32630
749 4XMM 8 L Antibody 57 light chain 9606
750 4NHH 1 F, G, K, L, P, Q 2G12 IgG dimer light chain 9606
751 4NHG 2 B, C, F, G, K, L 2G12 IgG dimer light chain 9606
752 6OT0 5 L Fab light chain 10090
753 6OGE 2 B Pertuzumab FAB LIGHT CHAIN 9606
754 6OGE 4 D Trastuzumab FAB LIGHT CHAIN 9606
755 6QD7 1 L, P, Z Light chain 9606
756 6QD8 1 L, Y, Z Light chain 9606
757 6NI2 4 L Fab30 Light Chain 32630
758 6NC3 4 L, T, U, V, W, X Monoclonal antibody VRC34.01 fragment antigen binding light chain 9606
759 6MZJ 2 C, L VRC01GL light chain germline VK3-11 with the mature CDRL3 of VRC01 9606
760 6MYY 2 C, F, L VRC01GL light chain germline VK3-11 with the mature CDR L3 of VRC01 9606
761 6MLM 4 G, I, L Light chain Fv of H7.5 Fab 9606
762 6MJZ 3 L PIA174 Fab Light chain 9606
763 6HJP 4 H, J, L Light chain of FISW84 Fab Fragment 9606
764 6HJQ 4 H, J, L Light chain of FISW84 Fab 9606
765 6E5P 1 1, 4, K, L, Q, T 2G12 Light chain 9606
766 6E1K 2 C, E cat06 light chain 9606
767 6DJP 6 F 68 light chain Fab 10090
768 6CMO 5 L Fab light chain 32630
769 6CM3 4 J, L, N 17b Fab light chain 9606
770 6BF7 3 D, F Fab H11-E light chain 10090
771 6BF9 3 D, F Fab H11-E light chain 10090
772 6B7Z 3 D, F FAB H11 light chain 10090
773 6B70 3 D, F FAB H11-E light chain 10090
774 5VN3 1 L, N, O 17b Fab light chain 9606
775 5THR 4 J, K, L 17b Fab VL domain 9606
776 5A8H 3 C, I, O FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
777 5A7X 3 C, G, K FAB OF BROADLY NEUTRALIZING ANTIBODY 17B 9606
778 3J70 2 B, N, S monoclonal antibody 17b heavy chain 9606
779 3CM9 3 L, M, N, O Ig alpha-2 chain C region 9606
780 3CHN 1 L, M, N, O Immunoglobulin kappa light chain 9606
781 2QTJ 1 L, M, N, O Kappa light chain IgA1 9606
782 2ESG 1 L, M Immunoglobulin A1 light chain 9606
783 1R70 1 A, C Human IgA2(m1) Light Chain 9606
784 1IGA 2 C, D IGA1 CHAINS A AND B, HEAVY, CHAINS C AND D, LIGHT 9606