
Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribosomal subunit

Sequence Similarity Clusters for the Entities in PDB 6N8L

Entity #1 | Chains: v
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 11 7661
95 % 7 11 8338
90 % 7 11 8375
70 % 7 11 8062
50 % 7 11 7666
40 % 7 11 7372
30 % 7 11 6847
Entity #10 | Chains: E
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 298
95 % 59 102 356
90 % 59 103 369
70 % 61 106 393
50 % 62 107 444
40 % 63 111 456
30 % 63 111 474
Entity #11 | Chains: e
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 265
95 % 60 104 348
90 % 60 104 368
70 % 61 106 395
50 % 85 189 274
40 % 85 193 279
30 % 85 194 287
Entity #12 | Chains: F
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 267
95 % 60 103 352
90 % 60 103 371
70 % 61 105 398
50 % 84 185 284
40 % 84 185 295
30 % 84 184 319
Entity #13 | Chains: f
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 102 274
95 % 59 102 362
90 % 59 102 383
70 % 60 104 408
50 % 82 181 308
40 % 83 183 311
30 % 83 183 328
Entity #14 | Chains: G
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 99 319
95 % 63 106 350
90 % 63 106 375
70 % 64 108 397
50 % 85 169 328
40 % 85 171 333
30 % 85 171 350
Entity #15 | Chains: g
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 300
95 % 59 97 400
90 % 59 97 412
70 % 60 99 430
50 % 82 170 329
40 % 82 170 335
30 % 82 170 354
Entity #16 | Chains: I
Bud site selection protein 20 protein, length: 166 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 20107
95 % 3 5 17740
90 % 3 5 17405
70 % 3 5 16210
50 % 3 5 14640
40 % 3 5 13591
30 % 3 5 12380
Entity #17 | Chains: H
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 102 272
95 % 60 102 357
90 % 60 102 378
70 % 61 104 405
50 % 84 193 270
40 % 152 265 193
30 % 153 266 203
Entity #18 | Chains: h
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 107 253
95 % 60 107 330
90 % 60 107 347
70 % 61 109 387
50 % 84 188 282
40 % 85 199 261
30 % 86 201 268
Entity #19 | Chains: i
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 98 294
95 % 59 102 365
90 % 59 102 386
70 % 60 104 411
50 % 60 104 461
40 % 83 178 316
30 % 83 178 331
Entity #2 | Chains: s
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: j
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 264
95 % 60 104 343
90 % 60 104 366
70 % 70 148 306
50 % 84 193 264
40 % 84 193 276
30 % 84 193 289
Entity #21 | Chains: k
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 303
95 % 59 97 401
90 % 59 97 416
70 % 60 99 437
50 % 60 99 484
40 % 61 106 472
30 % 61 106 493
Entity #22 | Chains: L
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 101 280
95 % 59 101 372
90 % 59 101 390
70 % 60 103 412
50 % 60 103 462
40 % 83 183 303
30 % 83 183 324
Entity #23 | Chains: l
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 101 278
95 % 61 101 363
90 % 61 101 384
70 % 83 176 276
50 % 84 189 273
40 % 84 191 282
30 % 85 192 294
Entity #24 | Chains: M
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 268
95 % 60 103 354
90 % 60 103 372
70 % 61 105 399
50 % 61 105 456
40 % 61 105 484
30 % 61 105 501
Entity #25 | Chains: p
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 94 308
95 % 60 94 406
90 % 60 94 422
70 % 61 96 444
50 % 84 184 285
40 % 85 185 293
30 % 107 208 256
Entity #26 | Chains: N
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 105 262
95 % 62 108 328
90 % 62 108 345
70 % 84 183 265
50 % 86 197 256
40 % 86 197 267
30 % 86 197 281
Entity #27 | Chains: u
Ribosome biogenesis protein RLP24 protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 13 5825
95 % 3 13 6791
90 % 3 13 6804
70 % 3 13 6670
50 % 3 13 6395
40 % 3 13 6188
30 % 3 13 5890
Entity #28 | Chains: O
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 305
95 % 54 95 402
90 % 60 102 377
70 % 61 104 404
50 % 84 185 281
40 % 84 186 291
30 % 84 186 309
Entity #29 | Chains: P
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 106 256
95 % 59 106 334
90 % 60 108 340
70 % 60 108 389
50 % 84 195 259
40 % 84 195 272
30 % 84 195 285
Entity #3 | Chains: A
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 97 292
95 % 60 97 392
90 % 61 99 397
70 % 83 174 278
50 % 84 187 277
40 % 152 258 200
30 % 152 258 210
Entity #30 | Chains: Q
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 266
95 % 60 103 349
90 % 61 105 355
70 % 61 105 396
50 % 83 186 289
40 % 83 191 287
30 % 83 191 305
Entity #31 | Chains: R
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 97 293
95 % 57 97 391
90 % 57 97 408
70 % 58 100 419
50 % 83 185 286
40 % 83 186 297
30 % 83 186 312
Entity #32 | Chains: S
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 101 283
95 % 59 101 377
90 % 60 103 382
70 % 60 103 414
50 % 82 176 319
40 % 83 177 320
30 % 83 178 332
Entity #33 | Chains: T
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 97 295
95 % 60 97 389
90 % 61 99 398
70 % 61 99 423
50 % 83 175 318
40 % 83 181 315
30 % 85 188 303
Entity #34 | Chains: U
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 72 456
95 % 40 72 597
90 % 40 72 629
70 % 41 73 650
50 % 41 73 683
40 % 41 73 715
30 % 42 74 717
Entity #35 | Chains: V
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 263
95 % 60 104 346
90 % 61 106 353
70 % 85 197 240
50 % 85 198 251
40 % 85 198 264
30 % 85 198 274
Entity #36 | Chains: W
Ribosome assembly factor MRT4 protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 11 7834
95 % 3 11 8346
90 % 3 11 8279
70 % 3 11 8070
50 % 3 11 7583
40 % 3 11 7291
30 % 3 11 6854
Entity #37 | Chains: X
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 41 77 425
95 % 41 77 556
90 % 42 78 573
70 % 42 78 599
50 % 42 78 638
40 % 42 80 655
30 % 42 81 669
Entity #38 | Chains: Y
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 108 249
95 % 60 108 324
90 % 61 110 335
70 % 61 110 381
50 % 85 193 266
40 % 85 193 278
30 % 85 193 291
Entity #39 | Chains: y
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 13 31 1882
95 % 13 31 2424
90 % 13 31 2487
70 % 14 32 2477
50 % 16 36 1982
40 % 16 36 2007
30 % 17 38 1879
Entity #4 | Chains: a
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 95 309
95 % 60 98 387
90 % 61 100 393
70 % 61 100 418
50 % 84 188 275
40 % 85 189 284
30 % 85 191 296
Entity #40 | Chains: Z
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 302
95 % 59 97 397
90 % 60 99 403
70 % 60 99 435
50 % 82 171 326
40 % 83 184 298
30 % 84 186 314
Entity #41 | Chains: z
UPF0642 protein YBL028C protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11543
95 % 3 8 12825
90 % 3 8 12037
70 % 3 8 12027
50 % 3 8 10576
40 % 3 8 9983
30 % 3 8 9249
Entity #42 | Chains: D
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 93 316
95 % 60 95 405
90 % 60 95 421
70 % 61 97 442
50 % 84 183 290
40 % 85 185 292
30 % 85 185 311
Entity #43 | Chains: J
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 37 75 483
95 % 60 98 385
90 % 61 100 392
70 % 85 186 257
50 % 87 190 271
40 % 87 190 283
30 % 87 190 298
Entity #44 | Chains: q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 94 307
95 % 60 94 408
90 % 61 96 410
70 % 83 174 279
50 % 85 181 298
40 % 85 182 306
30 % 85 182 326
Entity #45 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 89 329
95 % 59 89 432
90 % 60 91 440
70 % 60 91 466
50 % 60 91 505
40 % 60 91 540
30 % 60 91 566
Entity #46 | Chains: 1
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #47 | Chains: 2
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #48 | Chains: 3
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #5 | Chains: B
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 288
95 % 60 103 355
90 % 61 105 362
70 % 61 105 402
50 % 86 198 250
40 % 86 198 262
30 % 86 200 269
Entity #6 | Chains: b
Nucleolar GTP-binding protein 1 protein, length: 647 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 12 7263
95 % 3 12 7685
90 % 3 12 7568
70 % 3 12 7413
50 % 3 12 7069
40 % 3 12 6984
30 % 3 12 6567
Entity #7 | Chains: C
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 270
95 % 60 107 329
90 % 60 107 346
70 % 61 109 385
50 % 79 157 345
40 % 85 198 263
30 % 85 198 275
Entity #8 | Chains: c
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 103 261
95 % 62 103 341
90 % 63 105 351
70 % 63 105 392
50 % 77 146 363
40 % 77 146 374
30 % 77 146 388
Entity #9 | Chains: d
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 101 276
95 % 60 101 364
90 % 60 101 385
70 % 61 103 410
50 % 84 185 283
40 % 84 185 296
30 % 84 185 316


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 45 BG, DG 60S ribosomal protein L8-A 4932
2 4U4R 45 L8, l8 60S ribosomal protein L8-A 4932
3 5TBW 10 CJ, p 60S ribosomal protein L8-A 4932
4 4U3N 45 L8, l8 60S ribosomal protein L8-A 4932
5 4U52 45 L8, l8 60S ribosomal protein L8-A 4932
6 4U4Q 45 L8, l8 60S ribosomal protein L8-A 4932
7 4U6F 45 L8, l8 60S ribosomal protein L8-A 4932
8 4U4U 45 L8, l8 60S ribosomal protein L8-A 4932
9 4U4Z 45 L8, l8 60S ribosomal protein L8-A 4932
10 4U4Y 45 L8, l8 60S ribosomal protein L8-A 4932
11 4U4N 45 L8, l8 60S ribosomal protein L8-A 4932
12 4U55 45 L8, l8 60S ribosomal protein L8-A 4932
13 5DAT 45 L8, l8 60S ribosomal protein L8-A 4932
14 5I4L 45 L8 60S ribosomal protein L8-A 4932
15 5I4L 81 l8 60S ribosomal protein L8-A 4932
16 4U51 45 L8, l8 60S ribosomal protein L8-A 4932
17 6HHQ 10 CJ, p 60S ribosomal protein L8-A 4932
18 5OBM 10 L8, l8 60S ribosomal protein L8-A 4932
19 4U53 45 L8, l8 60S ribosomal protein L8-A 4932
20 5ON6 10 CJ, p 60S ribosomal protein L8-A 4932
21 4U50 45 L8, l8 60S ribosomal protein L8-A 4932
22 5NDV 10 L8, l8 60S ribosomal protein L8-A 4932
23 5LYB 45 L8 60S ribosomal protein L8-A 4932
24 4U56 45 L8, l8 60S ribosomal protein L8-A 4932
25 5TGA 45 L8, l8 60S ribosomal protein L8-A 4932
26 5MEI 10 CJ, p 60S ribosomal protein L8-A 4932
27 5FCJ 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
28 4U4O 45 L8, l8 60S ribosomal protein L8-A 4932
29 5NDW 33 L8, l8 60S ribosomal protein L8-A 4932
30 5NDG 45 L8, l8 60S ribosomal protein L8-A 4932
31 5FCI 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
32 5DC3 45 L8, l8 60S ribosomal protein L8-A 4932
33 5TGM 45 L8 60S ribosomal protein L8-A 4932
34 4V7R 39 BH, DH 60S ribosomal protein L8-A 4932
35 6TNU 47 AA 60S ribosomal protein L8-A 4932
36 6TB3 47 AA 60S ribosomal protein L8-A 4932
37 6T83 43 Gy, Ja 60S ribosomal protein L8-A 4932
38 6T7T 43 LG 60S ribosomal protein L8-A 4932
39 6T7I 43 LG 60S ribosomal protein L8-A 4932
40 6T4Q 42 LG 60S ribosomal protein L8-A 4932
41 6SV4 10 AA, XA, zA 60S ribosomal protein L8-A 4932
42 6SNT 43 n 60S ribosomal protein L8-A 4932
43 6S47 10 AJ 60S ribosomal protein L8-A 4932
44 6RZZ 8 H 60S ribosomal protein L8-A 4932
45 6S05 8 H 60S ribosomal protein L8-A 4932
46 6RI5 8 H 60S ribosomal protein L8-A 4932
47 6R84 7 K 60S ribosomal protein L8-A 4932
48 6R86 6 K 60S ribosomal protein L8-A 4932
49 6R87 6 K 60S ribosomal protein L8-A 4932
50 6QTZ 8 H 60S ribosomal protein L8-A 4932
51 6QT0 8 H 60S ribosomal protein L8-A 4932
52 6QIK 8 H 60S ribosomal protein L8-A 4932
53 6Q8Y 2 AA 60S ribosomal protein L8-A 4932
54 6N8J 14 G 60S ribosomal protein L8-A 4932
55 6N8K 14 G 60S ribosomal protein L8-A 4932
56 6N8L 14 G 60S ribosomal protein L8-A 4932
57 6N8M 11 J 60S ribosomal protein L8-A 4932
58 6N8N 14 J 60S ribosomal protein L8-A 4932
59 6N8O 15 J 60S ribosomal protein L8-A 4932
60 6I7O 10 AA, XA 60S ribosomal protein L8-A 4932
61 6HD7 14 K 60S ribosomal protein L8-A 4932
62 6GQV 12 G 60S ribosomal protein L8-A 4932
63 6GQ1 12 G 60S ribosomal protein L8-A 4932
64 6GQB 12 G 60S ribosomal protein L8-A 4932
65 6FT6 8 G 60S ribosomal protein L8-A 4932
66 6CB1 9 G 60S ribosomal protein L8-A 4932
67 5Z3G 11 K 60S ribosomal protein L8-A 4932
68 6C0F 10 G 60S ribosomal protein L8-A 4932
69 6EM1 21 G 60S ribosomal protein L8-A 4932
70 6EM3 13 G 60S ribosomal protein L8-A Backbone model 4932
71 6EM4 16 G 60S ribosomal protein L8-A Backbone model 4932
72 6EM5 21 G 60S ribosomal protein L8-A Backbone model 4932
73 6ELZ 53 G 60S ribosomal protein L8-A 4932
74 5MC6 41 AA 60S ribosomal protein L8-A 4932
75 5H4P 10 G 60S ribosomal protein L8-A 4932
76 5M1J 51 G5 60S ribosomal protein L8-A 4932
77 5T62 11 J 60S ribosomal protein L8-A 4932
78 5T6R 10 J 60S ribosomal protein L8-A 4932
79 5JUO 12 L eL8 (yeast L8) 4932
80 5JUP 12 L eL8 (yeast L8) 4932
81 5JUS 12 L eL8 (yeast L8) 4932
82 5JUT 12 L eL8 (yeast L8) 4932
83 5JUU 12 L eL8 (yeast L8) 4932
84 5JCS 13 G 60S ribosomal protein L8-A 4932
85 3JCT 7 G 60S ribosomal protein L8-A 4932
86 5GAK 27 K 60S ribosomal protein L8-A 4932
87 5FL8 7 G 60S ribosomal protein L8-A 4932
88 5APN 10 G 60S ribosomal protein L8-A 4932
89 5APO 10 G 60S ribosomal protein L8-A 4932
90 3J77 8 L8 60S ribosomal protein L8 4932
91 3J78 8 L8 60S ribosomal protein L8 4932
92 3J6X 11 L8 60S ribosomal protein L8 4932
93 3J6Y 11 L8 60S ribosomal protein L8 4932
94 4V91 10 G EL8 RIBOSOMAL PROTEIN EL8 28985
95 4V7F 11 H 60S ribosomal protein L8 4932
99 4V6I 37 BH 60S ribosomal protein rpL8 (L7ae) 4932