6N8L

Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8L

Entity #1 | Chains: v
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 11 7661
95 % 7 11 8338
90 % 7 11 8375
70 % 7 11 8062
50 % 7 11 7666
40 % 7 11 7372
30 % 7 11 6847
Entity #10 | Chains: E
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 298
95 % 59 102 356
90 % 59 103 369
70 % 61 106 393
50 % 62 107 444
40 % 63 111 456
30 % 63 111 474
Entity #11 | Chains: e
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 265
95 % 60 104 348
90 % 60 104 368
70 % 61 106 395
50 % 85 189 274
40 % 85 193 279
30 % 85 194 287
Entity #12 | Chains: F
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 267
95 % 60 103 352
90 % 60 103 371
70 % 61 105 398
50 % 84 185 284
40 % 84 185 295
30 % 84 184 319
Entity #13 | Chains: f
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 102 274
95 % 59 102 362
90 % 59 102 383
70 % 60 104 408
50 % 82 181 308
40 % 83 183 311
30 % 83 183 328
Entity #14 | Chains: G
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 99 319
95 % 63 106 350
90 % 63 106 375
70 % 64 108 397
50 % 85 169 328
40 % 85 171 333
30 % 85 171 350
Entity #15 | Chains: g
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 300
95 % 59 97 400
90 % 59 97 412
70 % 60 99 430
50 % 82 170 329
40 % 82 170 335
30 % 82 170 354
Entity #16 | Chains: I
Bud site selection protein 20 protein, length: 166 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 20107
95 % 3 5 17740
90 % 3 5 17405
70 % 3 5 16210
50 % 3 5 14640
40 % 3 5 13591
30 % 3 5 12380
Entity #17 | Chains: H
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 102 272
95 % 60 102 357
90 % 60 102 378
70 % 61 104 405
50 % 84 193 270
40 % 152 265 193
30 % 153 266 203
Entity #18 | Chains: h
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 107 253
95 % 60 107 330
90 % 60 107 347
70 % 61 109 387
50 % 84 188 282
40 % 85 199 261
30 % 86 201 268
Entity #19 | Chains: i
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 98 294
95 % 59 102 365
90 % 59 102 386
70 % 60 104 411
50 % 60 104 461
40 % 83 178 316
30 % 83 178 331
Entity #2 | Chains: s
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: j
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 264
95 % 60 104 343
90 % 60 104 366
70 % 70 148 306
50 % 84 193 264
40 % 84 193 276
30 % 84 193 289
Entity #21 | Chains: k
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 303
95 % 59 97 401
90 % 59 97 416
70 % 60 99 437
50 % 60 99 484
40 % 61 106 472
30 % 61 106 493
Entity #22 | Chains: L
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 101 280
95 % 59 101 372
90 % 59 101 390
70 % 60 103 412
50 % 60 103 462
40 % 83 183 303
30 % 83 183 324
Entity #23 | Chains: l
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 101 278
95 % 61 101 363
90 % 61 101 384
70 % 83 176 276
50 % 84 189 273
40 % 84 191 282
30 % 85 192 294
Entity #24 | Chains: M
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 268
95 % 60 103 354
90 % 60 103 372
70 % 61 105 399
50 % 61 105 456
40 % 61 105 484
30 % 61 105 501
Entity #25 | Chains: p
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 94 308
95 % 60 94 406
90 % 60 94 422
70 % 61 96 444
50 % 84 184 285
40 % 85 185 293
30 % 107 208 256
Entity #26 | Chains: N
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 105 262
95 % 62 108 328
90 % 62 108 345
70 % 84 183 265
50 % 86 197 256
40 % 86 197 267
30 % 86 197 281
Entity #27 | Chains: u
Ribosome biogenesis protein RLP24 protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 13 5825
95 % 3 13 6791
90 % 3 13 6804
70 % 3 13 6670
50 % 3 13 6395
40 % 3 13 6188
30 % 3 13 5890
Entity #28 | Chains: O
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 305
95 % 54 95 402
90 % 60 102 377
70 % 61 104 404
50 % 84 185 281
40 % 84 186 291
30 % 84 186 309
Entity #29 | Chains: P
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 106 256
95 % 59 106 334
90 % 60 108 340
70 % 60 108 389
50 % 84 195 259
40 % 84 195 272
30 % 84 195 285
Entity #3 | Chains: A
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 97 292
95 % 60 97 392
90 % 61 99 397
70 % 83 174 278
50 % 84 187 277
40 % 152 258 200
30 % 152 258 210
Entity #30 | Chains: Q
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 266
95 % 60 103 349
90 % 61 105 355
70 % 61 105 396
50 % 83 186 289
40 % 83 191 287
30 % 83 191 305
Entity #31 | Chains: R
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 97 293
95 % 57 97 391
90 % 57 97 408
70 % 58 100 419
50 % 83 185 286
40 % 83 186 297
30 % 83 186 312
Entity #32 | Chains: S
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 101 283
95 % 59 101 377
90 % 60 103 382
70 % 60 103 414
50 % 82 176 319
40 % 83 177 320
30 % 83 178 332
Entity #33 | Chains: T
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 97 295
95 % 60 97 389
90 % 61 99 398
70 % 61 99 423
50 % 83 175 318
40 % 83 181 315
30 % 85 188 303
Entity #34 | Chains: U
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 72 456
95 % 40 72 597
90 % 40 72 629
70 % 41 73 650
50 % 41 73 683
40 % 41 73 715
30 % 42 74 717
Entity #35 | Chains: V
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 263
95 % 60 104 346
90 % 61 106 353
70 % 85 197 240
50 % 85 198 251
40 % 85 198 264
30 % 85 198 274
Entity #36 | Chains: W
Ribosome assembly factor MRT4 protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 11 7834
95 % 3 11 8346
90 % 3 11 8279
70 % 3 11 8070
50 % 3 11 7583
40 % 3 11 7291
30 % 3 11 6854
Entity #37 | Chains: X
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 41 77 425
95 % 41 77 556
90 % 42 78 573
70 % 42 78 599
50 % 42 78 638
40 % 42 80 655
30 % 42 81 669
Entity #38 | Chains: Y
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 108 249
95 % 60 108 324
90 % 61 110 335
70 % 61 110 381
50 % 85 193 266
40 % 85 193 278
30 % 85 193 291
Entity #39 | Chains: y
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 13 31 1882
95 % 13 31 2424
90 % 13 31 2487
70 % 14 32 2477
50 % 16 36 1982
40 % 16 36 2007
30 % 17 38 1879
Entity #4 | Chains: a
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 95 309
95 % 60 98 387
90 % 61 100 393
70 % 61 100 418
50 % 84 188 275
40 % 85 189 284
30 % 85 191 296
Entity #40 | Chains: Z
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 302
95 % 59 97 397
90 % 60 99 403
70 % 60 99 435
50 % 82 171 326
40 % 83 184 298
30 % 84 186 314
Entity #41 | Chains: z
UPF0642 protein YBL028C protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11543
95 % 3 8 12825
90 % 3 8 12037
70 % 3 8 12027
50 % 3 8 10576
40 % 3 8 9983
30 % 3 8 9249
Entity #42 | Chains: D
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 93 316
95 % 60 95 405
90 % 60 95 421
70 % 61 97 442
50 % 84 183 290
40 % 85 185 292
30 % 85 185 311
Entity #43 | Chains: J
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 37 75 483
95 % 60 98 385
90 % 61 100 392
70 % 85 186 257
50 % 87 190 271
40 % 87 190 283
30 % 87 190 298
Entity #44 | Chains: q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 94 307
95 % 60 94 408
90 % 61 96 410
70 % 83 174 279
50 % 85 181 298
40 % 85 182 306
30 % 85 182 326
Entity #45 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 89 329
95 % 59 89 432
90 % 60 91 440
70 % 60 91 466
50 % 60 91 505
40 % 60 91 540
30 % 60 91 566
Entity #46 | Chains: 1
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #47 | Chains: 2
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #48 | Chains: 3
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #5 | Chains: B
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 288
95 % 60 103 355
90 % 61 105 362
70 % 61 105 402
50 % 86 198 250
40 % 86 198 262
30 % 86 200 269
Entity #6 | Chains: b
Nucleolar GTP-binding protein 1 protein, length: 647 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 12 7263
95 % 3 12 7685
90 % 3 12 7568
70 % 3 12 7413
50 % 3 12 7069
40 % 3 12 6984
30 % 3 12 6567
Entity #7 | Chains: C
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 270
95 % 60 107 329
90 % 60 107 346
70 % 61 109 385
50 % 79 157 345
40 % 85 198 263
30 % 85 198 275
Entity #8 | Chains: c
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 103 261
95 % 62 103 341
90 % 63 105 351
70 % 63 105 392
50 % 77 146 363
40 % 77 146 374
30 % 77 146 388
Entity #9 | Chains: d
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 101 276
95 % 60 101 364
90 % 60 101 385
70 % 61 103 410
50 % 84 185 283
40 % 84 185 296
30 % 84 185 316

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 74 Bk, Dk 60S ribosomal protein L38 4932
2 4U4R 74 O8, o8 60S ribosomal protein L38 4932
3 4U3U 74 O8, o8 60S ribosomal protein L38 4932
4 5TBW 39 AL, DM 60S ribosomal protein L38 4932
5 4U3M 74 O8, o8 60S ribosomal protein L38 4932
6 4U3N 74 O8, o8 60S ribosomal protein L38 4932
7 4U52 74 O8, o8 60S ribosomal protein L38 4932
8 4U4Q 74 O8, o8 60S ribosomal protein L38 4932
9 4U6F 74 O8, o8 60S ribosomal protein L38 4932
10 4U4U 74 O8, o8 60S ribosomal protein L38 4932
11 4U4Z 74 O8, o8 60S ribosomal protein L38 4932
12 4U4Y 74 O8, o8 60S ribosomal protein L38 4932
13 4U4N 74 O8, o8 60S ribosomal protein L38 4932
14 4U55 74 O8, o8 60S ribosomal protein L38 4932
15 5DAT 74 O8, o8 60S ribosomal protein L38 4932
16 5I4L 74 O8, o8 60S ribosomal protein L38 4932
17 4U51 74 O8, o8 60S ribosomal protein L38 4932
18 6HHQ 39 AL, DM 60S ribosomal protein L38 4932
19 5OBM 39 O8, o8 60S ribosomal protein L38 4932
20 4U53 74 O8, o8 60S ribosomal protein L38 4932
21 5ON6 40 AL, DM 60S ribosomal protein L38 4932
22 4U50 74 O8, o8 60S ribosomal protein L38 4932
23 5NDV 39 O8, o8 60S ribosomal protein L38 4932
24 5LYB 74 O8, o8 60S ribosomal protein L38 4932
25 4U56 74 O8, o8 60S ribosomal protein L38 4932
26 5TGA 74 O8, o8 60S ribosomal protein L38 4932
27 5MEI 40 AL, DM 60S ribosomal protein L38 4932
28 5FCJ 74 O8, o8 60S ribosomal protein L38 4932
29 4U4O 74 O8, o8 60S ribosomal protein L38 4932
30 5DGV 74 O8, o8 60S ribosomal protein L38 4932
31 5DGE 74 O8, o8 60S ribosomal protein L38 4932
32 5NDW 62 O8, o8 60S ribosomal protein L38 4932
33 4V8P 15 AP, DP, FP, HP RPL38 5911
34 5NDG 74 O8, o8 60S ribosomal protein L38 4932
35 5FCI 74 O8, o8 60S ribosomal protein L38 4932
36 5DC3 74 O8, o8 60S ribosomal protein L38 4932
37 5DGF 74 O8, o8 60S ribosomal protein L38 4932
38 5TGM 74 O8, o8 60S ribosomal protein L38 4932
39 6TNU 76 AI 60S ribosomal protein L38 4932
40 6UZ7 39 Bk KLLA0C18216p 28985
41 6TB3 76 AI 60S ribosomal protein L38 4932
42 6T83 72 V, kb 60S ribosomal protein L38 4932
43 6T7T 72 Lk 60S ribosomal protein L38 4932
44 6T7I 72 Lk 60S ribosomal protein L38 4932
45 6T4Q 71 Lk 60S ribosomal protein L38 4932
46 6SV4 73 AI, XI, zI 60S ribosomal protein L38 4932
47 6SNT 72 af 60S ribosomal protein L38 4932
48 6S47 39 Am 60S ribosomal protein L38 4932
49 6RZZ 35 j 60S ribosomal protein L38 4932
50 6S05 35 j 60S ribosomal protein L38 4932
51 6RI5 35 j 60S ribosomal protein L38 4932
52 6R84 12 m 60S ribosomal protein L38 4932
53 6R86 11 m 60S ribosomal protein L38 4932
54 6R87 11 m 60S ribosomal protein L38 4932
55 6QTZ 35 j 60S ribosomal protein L38 4932
56 6QT0 36 j 60S ribosomal protein L38 4932
57 6QIK 35 j 60S ribosomal protein L38 4932
58 6Q8Y 10 AI 60S ribosomal protein L38 4932
59 6N8J 21 k 60S ribosomal protein L38 4932
60 6N8K 21 k 60S ribosomal protein L38 4932
61 6N8L 21 k 60S ribosomal protein L38 4932
62 6N8M 42 x 60S ribosomal protein L38 4932
63 6N8N 45 x 60S ribosomal protein L38 4932
64 6N8O 47 x 60S ribosomal protein L38 4932
65 6I7O 73 AI, XI 60S ribosomal protein L38 4932
66 6HD7 42 m 60S ribosomal protein L38 4932
67 6GQV 41 k 60S ribosomal protein L38 4932
68 6GQ1 41 k 60S ribosomal protein L38 4932
69 6GQB 41 k 60S ribosomal protein L38 4932
70 6FT6 37 k 60S ribosomal protein L38 4932
71 6CB1 32 k 60S ribosomal protein L38 4932
72 6EM5 19 k 60S ribosomal protein L38 Backbone model 4932
73 6ELZ 19 k 60S ribosomal protein L38 4932
74 5XXB 39 j Ribosomal protein eL38 5811
75 5UMD 40 d 60S ribosomal protein L38 5833
76 5MC6 49 AI 60S ribosomal protein L38 4932
77 5H4P 38 k 60S ribosomal protein L38 MAREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSLYTLVINDAG KAKKLIQSLPPTLKVNRL 4932
78 5M1J 58 k5 60S ribosomal protein L38 4932
79 5T62 40 x 60S ribosomal protein L38 4932
80 5T6R 39 x 60S ribosomal protein L38 4932
81 5JUO 42 PA eL38 (yeast L38) 4932
82 5JUP 42 PA eL38 (yeast L38) 4932
83 5JUS 42 PA eL38 (yeast L38) 4932
84 5JUT 42 PA eL38 (yeast L38) 4932
85 5JUU 42 PA eL38 (yeast L38) 4932
86 5JCS 18 k 60S ribosomal protein L38 4932
87 5IT7 39 kk KLLA0C18216p 28985
88 3JCT 37 k 60S ribosomal protein L38 4932
89 5GAK 32 m 60S ribosomal protein L38 4932
90 5FL8 35 k 60S ribosomal protein L38 4932
91 5APN 39 k 60S ribosomal protein L38 4932
92 5APO 39 k 60S ribosomal protein L38 4932
93 3JBN 48 Ad 60S ribosomal protein eL38 5833
94 3JBO 51 Ad 60S ribosomal protein eL38 5833
95 3JBP 48 Ad 60S ribosomal protein eL38 5833
96 3J79 40 d 60S ribosomal protein eL38 5833
97 3J77 38 88 60S ribosomal protein L38 4932
98 3J78 38 88 60S ribosomal protein L38 4932
99 3J6X 40 78 60S ribosomal protein L38 4932
100 3J6Y 40 78 60S ribosomal protein L38 4932
101 4V91 39 k EL38 RIBOSOMAL PROTEIN EL38 28985
102 4V7F 38 i 60S ribosomal protein L38 4932
103 4V8Y 71 Bk 60S RIBOSOMAL PROTEIN L38 4932
104 4V8Z 71 Bk 60S RIBOSOMAL PROTEIN L38 4932
105 4V8T 37 k 60S RIBOSOMAL PROTEIN L38 4932
106 4V6I 65 Bn 60S ribosomal protein rpL38 (L38e) 4932