6N8L

Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8L

Entity #1 | Chains: v
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 11 8114
95 % 7 11 8518
90 % 7 11 8612
70 % 7 11 8236
50 % 7 11 7870
40 % 10 14 6038
30 % 10 14 5757
Entity #10 | Chains: E
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 64 107 292
95 % 69 112 350
90 % 69 113 362
70 % 71 116 390
50 % 72 117 434
40 % 73 121 449
30 % 73 121 464
Entity #11 | Chains: e
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 114 270
95 % 70 114 338
90 % 70 114 356
70 % 71 116 389
50 % 107 211 264
40 % 107 215 261
30 % 107 216 275
Entity #12 | Chains: F
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 113 272
95 % 70 113 344
90 % 70 113 363
70 % 71 115 394
50 % 106 207 273
40 % 106 207 279
30 % 106 206 296
Entity #13 | Chains: f
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 112 283
95 % 69 112 360
90 % 69 112 381
70 % 70 114 411
50 % 104 203 291
40 % 105 205 297
30 % 106 206 306
Entity #14 | Chains: G
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 66 109 311
95 % 73 116 347
90 % 73 116 361
70 % 74 118 393
50 % 107 191 308
40 % 107 193 317
30 % 107 193 332
Entity #15 | Chains: g
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 107 299
95 % 69 107 384
90 % 69 107 409
70 % 70 109 433
50 % 104 192 307
40 % 104 192 318
30 % 104 192 336
Entity #16 | Chains: I
Bud site selection protein 20 protein, length: 166 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 9 10353
95 % 7 9 10657
90 % 7 9 10572
70 % 7 9 10298
50 % 7 9 9586
40 % 7 9 9136
30 % 7 9 8197
Entity #17 | Chains: H
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 111 279
95 % 70 112 348
90 % 70 112 368
70 % 71 114 403
50 % 106 215 263
40 % 107 216 260
30 % 108 218 270
Entity #18 | Chains: h
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 117 258
95 % 70 117 324
90 % 70 117 344
70 % 71 119 378
50 % 106 210 272
40 % 107 221 252
30 % 108 223 259
Entity #19 | Chains: i
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 108 295
95 % 69 112 358
90 % 69 112 373
70 % 70 114 407
50 % 70 114 461
40 % 105 200 302
30 % 105 210 290
Entity #2 | Chains: s
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: j
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 114 263
95 % 70 114 336
90 % 70 114 357
70 % 92 170 296
50 % 106 215 256
40 % 106 215 262
30 % 106 215 276
Entity #21 | Chains: k
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 107 297
95 % 69 107 381
90 % 69 107 408
70 % 70 109 428
50 % 70 109 470
40 % 71 116 463
30 % 71 116 481
Entity #22 | Chains: L
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 111 286
95 % 69 111 366
90 % 69 111 387
70 % 70 113 416
50 % 70 113 462
40 % 105 205 288
30 % 105 205 300
Entity #23 | Chains: l
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 71 111 282
95 % 71 111 356
90 % 71 111 377
70 % 105 198 265
50 % 109 216 255
40 % 109 216 259
30 % 110 217 273
Entity #24 | Chains: M
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 113 276
95 % 70 113 342
90 % 70 113 364
70 % 71 115 398
50 % 71 115 453
40 % 71 115 473
30 % 71 115 496
Entity #25 | Chains: p
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 103 306
95 % 69 103 399
90 % 69 103 421
70 % 70 105 441
50 % 105 205 277
40 % 106 206 282
30 % 128 229 253
Entity #26 | Chains: N
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 115 264
95 % 72 118 325
90 % 72 118 345
70 % 106 205 255
50 % 108 219 253
40 % 108 219 255
30 % 108 219 269
Entity #27 | Chains: u
Ribosome biogenesis protein RLP24 protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 18 3912
95 % 8 18 4970
90 % 8 18 4793
70 % 8 18 4807
50 % 8 18 4684
40 % 8 18 4766
30 % 8 18 4491
Entity #28 | Chains: O
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 64 105 303
95 % 64 105 390
90 % 70 112 369
70 % 71 114 402
50 % 106 207 270
40 % 106 208 275
30 % 106 208 291
Entity #29 | Chains: P
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 116 260
95 % 69 116 330
90 % 70 118 343
70 % 70 118 383
50 % 106 217 254
40 % 106 217 258
30 % 106 217 272
Entity #3 | Chains: A
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 106 300
95 % 69 106 382
90 % 70 108 397
70 % 104 195 268
50 % 105 208 267
40 % 176 282 196
30 % 176 282 206
Entity #30 | Chains: Q
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 113 274
95 % 70 113 346
90 % 71 115 355
70 % 71 115 397
50 % 105 208 278
40 % 105 213 273
30 % 105 213 286
Entity #31 | Chains: R
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 107 294
95 % 67 107 378
90 % 67 107 405
70 % 68 110 423
50 % 105 207 275
40 % 105 208 277
30 % 105 208 295
Entity #32 | Chains: S
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 111 285
95 % 69 111 365
90 % 70 113 372
70 % 70 113 415
50 % 104 198 299
40 % 105 199 304
30 % 105 200 314
Entity #33 | Chains: T
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 107 293
95 % 70 107 377
90 % 71 109 391
70 % 71 109 425
50 % 105 197 301
40 % 105 203 301
30 % 107 210 287
Entity #34 | Chains: U
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 49 81 432
95 % 49 81 548
90 % 49 81 576
70 % 50 82 590
50 % 50 82 635
40 % 50 82 677
30 % 51 83 677
Entity #35 | Chains: V
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 114 262
95 % 70 114 335
90 % 71 116 349
70 % 107 219 240
50 % 110 225 248
40 % 110 225 249
30 % 113 232 247
Entity #36 | Chains: W
Ribosome assembly factor MRT4 protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 16 4963
95 % 8 16 5452
90 % 8 16 5836
70 % 8 16 5498
50 % 8 16 5324
40 % 8 16 5434
30 % 8 16 5019
Entity #37 | Chains: X
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 86 406
95 % 50 86 518
90 % 51 87 537
70 % 51 87 564
50 % 51 87 595
40 % 51 89 628
30 % 51 90 646
Entity #38 | Chains: Y
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 118 253
95 % 70 118 321
90 % 71 120 332
70 % 71 120 373
50 % 107 215 257
40 % 107 215 263
30 % 107 215 277
Entity #39 | Chains: y
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 18 36 1674
95 % 18 36 2128
90 % 18 36 2186
70 % 23 41 1914
50 % 25 45 1655
40 % 25 45 1682
30 % 26 47 1609
Entity #4 | Chains: a
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 105 304
95 % 70 108 368
90 % 71 110 382
70 % 71 110 420
50 % 106 210 265
40 % 107 211 270
30 % 110 216 274
Entity #40 | Chains: Z
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 107 298
95 % 69 107 383
90 % 70 109 398
70 % 70 109 431
50 % 104 193 306
40 % 105 206 285
30 % 106 208 294
Entity #41 | Chains: z
UPF0642 protein YBL028C protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 13 6049
95 % 8 13 7114
90 % 8 13 7054
70 % 8 13 6959
50 % 8 13 6703
40 % 8 13 6456
30 % 8 13 6148
Entity #42 | Chains: D
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 101 312
95 % 68 103 400
90 % 68 103 420
70 % 69 105 440
50 % 104 203 283
40 % 105 205 284
30 % 105 205 298
Entity #43 | Chains: J
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 43 81 499
95 % 68 106 385
90 % 69 108 401
70 % 105 206 252
50 % 107 210 266
40 % 107 210 271
30 % 107 210 283
Entity #44 | Chains: q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 65 99 319
95 % 65 99 417
90 % 66 101 431
70 % 100 194 269
50 % 102 201 288
40 % 102 202 296
30 % 102 202 309
Entity #45 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 64 94 345
95 % 64 94 441
90 % 65 96 456
70 % 65 96 474
50 % 65 96 518
40 % 65 96 542
30 % 65 96 574
Entity #46 | Chains: 1
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #47 | Chains: 2
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #48 | Chains: 3
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #5 | Chains: B
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 68 111 288
95 % 70 113 345
90 % 71 115 352
70 % 71 115 395
50 % 108 220 251
40 % 108 220 253
30 % 108 222 260
Entity #6 | Chains: b
Nucleolar GTP-binding protein 1 protein, length: 647 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 8 17 4387
95 % 8 17 5041
90 % 8 17 5275
70 % 8 17 5088
50 % 8 17 5097
40 % 10 19 4407
30 % 10 19 4314
Entity #7 | Chains: C
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 113 273
95 % 70 117 327
90 % 70 117 346
70 % 71 119 379
50 % 89 167 341
40 % 107 220 254
30 % 107 220 264
Entity #8 | Chains: c
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 113 267
95 % 72 113 337
90 % 73 115 351
70 % 73 115 386
50 % 87 156 363
40 % 87 156 379
30 % 87 156 391
Entity #9 | Chains: d
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 111 280
95 % 70 111 353
90 % 70 111 375
70 % 71 113 409
50 % 106 207 271
40 % 106 207 278
30 % 106 207 293

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 74 Bk, Dk 60S ribosomal protein L38 4932
2 4U4R 74 O8, o8 60S ribosomal protein L38 4932
3 4U3U 74 O8, o8 60S ribosomal protein L38 4932
4 5TBW 39 AL, DM 60S ribosomal protein L38 4932
5 4U3M 74 O8, o8 60S ribosomal protein L38 4932
6 4U3N 74 O8, o8 60S ribosomal protein L38 4932
7 4U52 74 O8, o8 60S ribosomal protein L38 4932
8 4U4Q 74 O8, o8 60S ribosomal protein L38 4932
9 4U6F 74 O8, o8 60S ribosomal protein L38 4932
10 4U4U 74 O8, o8 60S ribosomal protein L38 4932
11 4U4Z 74 O8, o8 60S ribosomal protein L38 4932
12 4U4Y 74 O8, o8 60S ribosomal protein L38 4932
13 4U4N 74 O8, o8 60S ribosomal protein L38 4932
14 4U55 74 O8, o8 60S ribosomal protein L38 4932
15 5DAT 74 O8, o8 60S ribosomal protein L38 4932
16 5I4L 74 O8, o8 60S ribosomal protein L38 4932
17 4U51 74 O8, o8 60S ribosomal protein L38 4932
18 6HHQ 39 AL, DM 60S ribosomal protein L38 4932
19 5OBM 39 O8, o8 60S ribosomal protein L38 4932
20 4U53 74 O8, o8 60S ribosomal protein L38 4932
21 5ON6 40 AL, DM 60S ribosomal protein L38 4932
22 4U50 74 O8, o8 60S ribosomal protein L38 4932
23 5NDV 39 O8, o8 60S ribosomal protein L38 4932
24 5LYB 74 O8, o8 60S ribosomal protein L38 4932
25 4U56 74 O8, o8 60S ribosomal protein L38 4932
26 5TGA 74 O8, o8 60S ribosomal protein L38 4932
27 5MEI 40 AL, DM 60S ribosomal protein L38 4932
28 5FCJ 74 O8, o8 60S ribosomal protein L38 4932
29 4U4O 74 O8, o8 60S ribosomal protein L38 4932
30 5DGV 74 O8, o8 60S ribosomal protein L38 4932
31 5DGE 74 O8, o8 60S ribosomal protein L38 4932
32 5NDW 62 O8, o8 60S ribosomal protein L38 4932
33 5NDG 74 O8, o8 60S ribosomal protein L38 4932
34 5FCI 74 O8, o8 60S ribosomal protein L38 4932
35 5DC3 74 O8, o8 60S ribosomal protein L38 4932
36 5DGF 74 O8, o8 60S ribosomal protein L38 4932
37 5TGM 74 O8, o8 60S ribosomal protein L38 4932
38 6XIQ 43 k RPL38 isoform 1 4932
39 6XIR 41 k RPL38 isoform 1 4932
40 6Z6J 74 Lk 60S ribosomal protein L38 4932
41 6Z6K 74 Lk 60S ribosomal protein L38 4932
42 6WOO 39 k eL38 4932
43 6YLG 42 k 60S ribosomal protein L38 4932
44 6YLH 42 k 60S ribosomal protein L38 4932
45 6YLX 33 k 60S ribosomal protein L38 4932
46 6YLY 19 k 60S ribosomal protein L38 4932
47 6M62 43 k 60S ribosomal protein L38 4932
48 6TNU 76 AI 60S ribosomal protein L38 4932
49 6TB3 76 AI 60S ribosomal protein L38 4932
50 6T83 72 V, kb 60S ribosomal protein L38 4932
51 6T7T 72 Lk 60S ribosomal protein L38 4932
52 6T7I 72 Lk 60S ribosomal protein L38 4932
53 6T4Q 71 Lk 60S ribosomal protein L38 4932
54 6SV4 73 AI, XI, zI 60S ribosomal protein L38 4932
55 6SNT 72 af 60S ribosomal protein L38 4932
56 6S47 39 Am 60S ribosomal protein L38 4932
57 6RZZ 35 j 60S ribosomal protein L38 4932
58 6S05 35 j 60S ribosomal protein L38 4932
59 6RI5 35 j 60S ribosomal protein L38 4932
60 6R84 12 m 60S ribosomal protein L38 4932
61 6R86 11 m 60S ribosomal protein L38 4932
62 6R87 11 m 60S ribosomal protein L38 4932
63 6QTZ 35 j 60S ribosomal protein L38 4932
64 6QT0 36 j 60S ribosomal protein L38 4932
65 6QIK 35 j 60S ribosomal protein L38 4932
66 6Q8Y 10 AI 60S ribosomal protein L38 4932
67 6N8J 21 k 60S ribosomal protein L38 4932
68 6N8K 21 k 60S ribosomal protein L38 4932
69 6N8L 21 k 60S ribosomal protein L38 4932
70 6N8M 42 x 60S ribosomal protein L38 4932
71 6N8N 45 x 60S ribosomal protein L38 4932
72 6N8O 47 x 60S ribosomal protein L38 4932
73 6I7O 73 AI, XI 60S ribosomal protein L38 4932
74 6HD7 42 m 60S ribosomal protein L38 4932
75 6GQV 41 k 60S ribosomal protein L38 4932
76 6GQ1 41 k 60S ribosomal protein L38 4932
77 6GQB 41 k 60S ribosomal protein L38 4932
78 6FT6 37 k 60S ribosomal protein L38 4932
79 6CB1 32 k 60S ribosomal protein L38 4932
80 6EM5 19 k 60S ribosomal protein L38 Backbone model 4932
81 6ELZ 19 k 60S ribosomal protein L38 4932
82 5MC6 49 AI 60S ribosomal protein L38 4932
83 5H4P 38 k 60S ribosomal protein L38 MAREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSLYTLVINDAG KAKKLIQSLPPTLKVNRL 4932
84 5M1J 58 k5 60S ribosomal protein L38 4932
85 5T62 40 x 60S ribosomal protein L38 4932
86 5T6R 39 x 60S ribosomal protein L38 4932
87 5JUO 42 PA eL38 (yeast L38) 4932
88 5JUP 42 PA eL38 (yeast L38) 4932
89 5JUS 42 PA eL38 (yeast L38) 4932
90 5JUT 42 PA eL38 (yeast L38) 4932
91 5JUU 42 PA eL38 (yeast L38) 4932
92 5JCS 18 k 60S ribosomal protein L38 4932
93 3JCT 37 k 60S ribosomal protein L38 4932
94 5GAK 32 m 60S ribosomal protein L38 4932
95 5FL8 35 k 60S ribosomal protein L38 4932
96 5APN 39 k 60S ribosomal protein L38 4932
97 5APO 39 k 60S ribosomal protein L38 4932
98 3J77 38 88 60S ribosomal protein L38 4932
99 3J78 38 88 60S ribosomal protein L38 4932
100 3J6X 40 78 60S ribosomal protein L38 4932
101 3J6Y 40 78 60S ribosomal protein L38 4932
102 4V91 39 k EL38 RIBOSOMAL PROTEIN EL38 28985
103 4V7F 38 i 60S ribosomal protein L38 4932
104 4V8Y 71 Bk 60S RIBOSOMAL PROTEIN L38 4932
105 4V8Z 71 Bk 60S RIBOSOMAL PROTEIN L38 4932
106 4V8T 37 k 60S RIBOSOMAL PROTEIN L38 4932
107 4V6I 65 Bn 60S ribosomal protein rpL38 (L38e) 4932