6N8L

Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8L

Entity #1 | Chains: v
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 11 7567
95 % 7 11 8076
90 % 7 11 8021
70 % 7 11 7811
50 % 7 11 7350
40 % 7 11 7076
30 % 7 11 6651
Entity #10 | Chains: E
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 275
95 % 57 100 350
90 % 57 101 361
70 % 59 104 382
50 % 60 105 439
40 % 61 109 452
30 % 61 109 472
Entity #11 | Chains: e
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 102 250
95 % 58 102 336
90 % 58 102 355
70 % 59 104 383
50 % 79 183 267
40 % 79 187 270
30 % 79 188 284
Entity #12 | Chains: F
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 259
95 % 58 101 348
90 % 58 101 365
70 % 59 103 391
50 % 78 179 280
40 % 78 179 292
30 % 78 178 320
Entity #13 | Chains: f
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 100 263
95 % 57 100 361
90 % 57 100 376
70 % 58 102 400
50 % 76 175 304
40 % 77 177 308
30 % 77 177 330
Entity #14 | Chains: G
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 309
95 % 61 104 345
90 % 61 104 362
70 % 62 106 388
50 % 79 163 331
40 % 79 165 339
30 % 79 165 357
Entity #15 | Chains: g
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 95 286
95 % 57 95 381
90 % 57 95 400
70 % 58 97 418
50 % 76 164 328
40 % 76 164 342
30 % 76 164 358
Entity #16 | Chains: I
Bud site selection protein 20 protein, length: 166 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 19096
95 % 3 5 18611
90 % 3 5 18280
70 % 3 5 17006
50 % 3 5 15271
40 % 3 5 14190
30 % 3 5 12916
Entity #17 | Chains: H
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 100 262
95 % 58 100 353
90 % 58 100 370
70 % 59 102 396
50 % 78 187 263
40 % 79 189 265
30 % 147 260 202
Entity #18 | Chains: h
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 105 244
95 % 58 105 324
90 % 58 105 340
70 % 59 107 376
50 % 78 182 278
40 % 79 193 254
30 % 80 195 266
Entity #19 | Chains: i
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 96 280
95 % 57 100 356
90 % 57 100 373
70 % 58 102 398
50 % 58 102 455
40 % 77 172 311
30 % 77 172 337
Entity #2 | Chains: s
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: j
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 102 254
95 % 58 102 339
90 % 58 102 357
70 % 65 143 307
50 % 78 187 257
40 % 78 187 271
30 % 78 187 287
Entity #21 | Chains: k
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 95 288
95 % 57 95 386
90 % 57 95 401
70 % 58 97 421
50 % 58 97 472
40 % 59 104 469
30 % 59 104 483
Entity #22 | Chains: L
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 99 270
95 % 57 99 365
90 % 57 99 381
70 % 58 101 403
50 % 58 101 458
40 % 77 177 300
30 % 77 177 325
Entity #23 | Chains: l
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 99 265
95 % 59 99 358
90 % 59 99 372
70 % 77 171 270
50 % 78 183 265
40 % 78 185 274
30 % 79 186 294
Entity #24 | Chains: M
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 260
95 % 58 101 347
90 % 58 101 363
70 % 59 103 390
50 % 59 103 450
40 % 59 103 476
30 % 59 103 491
Entity #25 | Chains: p
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 92 299
95 % 58 92 394
90 % 58 92 408
70 % 59 94 429
50 % 78 178 283
40 % 79 179 291
30 % 101 202 253
Entity #26 | Chains: N
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 103 253
95 % 60 106 322
90 % 60 106 337
70 % 78 177 262
50 % 80 191 249
40 % 80 191 262
30 % 80 191 276
Entity #27 | Chains: u
Ribosome biogenesis protein RLP24 protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 13 5823
95 % 3 13 6610
90 % 3 13 6622
70 % 3 13 6541
50 % 3 13 6243
40 % 3 13 6061
30 % 3 13 5781
Entity #28 | Chains: O
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 93 291
95 % 52 93 389
90 % 58 100 366
70 % 59 102 392
50 % 78 179 276
40 % 78 180 284
30 % 78 180 312
Entity #29 | Chains: P
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 104 246
95 % 57 104 331
90 % 58 106 334
70 % 58 106 377
50 % 78 189 251
40 % 78 189 266
30 % 78 189 281
Entity #3 | Chains: A
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 95 281
95 % 58 95 377
90 % 59 97 385
70 % 77 168 273
50 % 78 181 273
40 % 146 252 198
30 % 146 252 208
Entity #30 | Chains: Q
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 257
95 % 58 101 344
90 % 59 103 352
70 % 59 103 387
50 % 77 180 287
40 % 77 185 282
30 % 77 185 308
Entity #31 | Chains: R
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 55 95 282
95 % 55 95 376
90 % 55 95 393
70 % 56 98 408
50 % 77 179 282
40 % 77 180 289
30 % 77 180 316
Entity #32 | Chains: S
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 99 274
95 % 57 99 364
90 % 58 101 369
70 % 58 101 402
50 % 76 170 316
40 % 77 171 318
30 % 77 172 339
Entity #33 | Chains: T
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 95 284
95 % 58 95 379
90 % 59 97 382
70 % 59 97 415
50 % 77 169 313
40 % 77 175 310
30 % 79 182 310
Entity #34 | Chains: U
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 72 433
95 % 40 72 572
90 % 40 72 599
70 % 41 73 614
50 % 41 73 659
40 % 41 73 692
30 % 42 74 691
Entity #35 | Chains: V
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 102 251
95 % 58 102 338
90 % 59 104 346
70 % 79 191 227
50 % 79 192 245
40 % 79 192 258
30 % 79 192 272
Entity #36 | Chains: W
Ribosome assembly factor MRT4 protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 11 7627
95 % 3 11 8199
90 % 3 11 8140
70 % 3 11 7929
50 % 3 11 7455
40 % 3 11 7188
30 % 3 11 6746
Entity #37 | Chains: X
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 41 77 399
95 % 41 77 528
90 % 42 78 543
70 % 42 78 574
50 % 42 78 616
40 % 42 80 630
30 % 42 81 645
Entity #38 | Chains: Y
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 106 242
95 % 58 106 319
90 % 59 108 326
70 % 59 108 372
50 % 79 190 247
40 % 79 190 260
30 % 79 190 275
Entity #39 | Chains: y
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 13 31 1791
95 % 13 31 2341
90 % 13 31 2393
70 % 14 32 2381
50 % 16 36 1911
40 % 16 36 1948
30 % 17 38 1836
Entity #4 | Chains: a
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 93 297
95 % 58 96 373
90 % 59 98 377
70 % 59 98 406
50 % 78 182 271
40 % 79 183 276
30 % 79 185 296
Entity #40 | Chains: Z
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 95 287
95 % 57 95 385
90 % 58 97 388
70 % 58 97 420
50 % 76 165 326
40 % 77 178 295
30 % 78 180 317
Entity #41 | Chains: z
UPF0642 protein YBL028C protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10852
95 % 3 8 11955
90 % 3 8 11807
70 % 3 8 11274
50 % 3 8 10340
40 % 3 8 9906
30 % 3 8 9168
Entity #42 | Chains: D
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 91 304
95 % 58 93 390
90 % 58 93 404
70 % 59 95 427
50 % 78 177 286
40 % 79 179 288
30 % 79 179 314
Entity #43 | Chains: J
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 73 475
95 % 58 96 372
90 % 59 98 380
70 % 79 180 252
50 % 81 184 261
40 % 81 184 275
30 % 81 184 299
Entity #44 | Chains: q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 92 296
95 % 58 92 393
90 % 59 94 395
70 % 77 168 277
50 % 79 175 296
40 % 79 176 302
30 % 79 176 327
Entity #45 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 87 315
95 % 57 87 423
90 % 58 89 434
70 % 58 89 462
50 % 58 89 496
40 % 58 89 531
30 % 58 89 552
Entity #46 | Chains: 1
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #47 | Chains: 2
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #48 | Chains: 3
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #5 | Chains: B
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 99 276
95 % 58 101 346
90 % 59 103 351
70 % 59 103 389
50 % 80 192 244
40 % 80 192 256
30 % 80 194 268
Entity #6 | Chains: b
Nucleolar GTP-binding protein 1 protein, length: 647 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 12 6668
95 % 3 12 6780
90 % 3 12 6798
70 % 3 12 6697
50 % 3 12 6395
40 % 3 12 6211
30 % 3 12 5906
Entity #7 | Chains: C
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 256
95 % 58 105 321
90 % 58 105 336
70 % 59 107 374
50 % 76 154 341
40 % 79 192 257
30 % 79 192 270
Entity #8 | Chains: c
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 101 255
95 % 60 101 341
90 % 61 103 348
70 % 61 103 385
50 % 74 143 355
40 % 74 143 368
30 % 74 143 386
Entity #9 | Chains: d
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 99 266
95 % 58 99 359
90 % 58 99 375
70 % 59 101 399
50 % 78 179 281
40 % 78 179 293
30 % 78 179 318

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 64 Ba, Da 60S ribosomal protein L28 4932
2 4U4R 64 N8, n8 60S ribosomal protein L28 4932
3 4U3U 64 N8, n8 60S ribosomal protein L28 4932
4 5TBW 29 AB, DC 60S ribosomal protein L28 4932
5 4U3M 64 N8, n8 60S ribosomal protein L28 4932
6 4U3N 64 N8, n8 60S ribosomal protein L28 4932
7 4U52 64 N8, n8 60S ribosomal protein L28 4932
8 4U4Q 64 N8, n8 60S ribosomal protein L28 4932
9 4U6F 64 N8, n8 60S ribosomal protein L28 4932
10 4U4U 64 N8, n8 60S ribosomal protein L28 4932
11 4U4Z 64 N8, n8 60S ribosomal protein L28 4932
12 4U4Y 64 N8, n8 60S ribosomal protein L28 4932
13 4U4N 64 N8, n8 60S ribosomal protein L28 4932
14 4U55 64 N8, n8 60S ribosomal protein L28 4932
15 5DAT 64 N8, n8 60S ribosomal protein L28 4932
16 5I4L 64 N8, n8 60S ribosomal protein L28 4932
17 4U51 64 N8, n8 60S ribosomal protein L28 4932
18 6HHQ 29 AB, DC 60S ribosomal protein L28 4932
19 5OBM 29 N8, n8 60S ribosomal protein L28 4932
20 4U53 64 N8, n8 60S ribosomal protein L28 4932
21 5ON6 30 AB, DC 60S ribosomal protein L28 4932
22 4U50 64 N8, n8 60S ribosomal protein L28 4932
23 5NDV 29 N8, n8 60S ribosomal protein L28 4932
24 5LYB 64 N8, n8 60S ribosomal protein L28 4932
25 4U56 64 N8, n8 60S ribosomal protein L28 4932
26 5TGA 64 N8, n8 60S ribosomal protein L28 4932
27 5MEI 30 AB, DC 60S ribosomal protein L28 4932
28 5FCJ 64 N8, n8 60S ribosomal protein L28 4932
29 4U4O 64 N8, n8 60S ribosomal protein L28 4932
30 5DGV 64 N8, n8 60S ribosomal protein L28 4932
31 5DGE 64 N8, n8 60S ribosomal protein L28 4932
32 5NDW 52 N8, n8 60S ribosomal protein L28 4932
33 4V8P 32 BK, CK, EK, GK 60S RIBOSOMAL PROTEIN L27A 5911
34 5NDG 64 N8, n8 60S ribosomal protein L28 4932
35 5FCI 64 N8, n8 60S ribosomal protein L28 4932
36 5DC3 64 N8, n8 60S ribosomal protein L28 4932
37 5DGF 64 N8, n8 60S ribosomal protein L28 4932
38 5TGM 64 N8, n8 60S ribosomal protein L28 4932
39 4V7R 54 BY, DY 60S ribosomal protein L28 4932
40 6UZ7 29 Ba RPL28 28985
41 6T83 62 L, ay 60S ribosomal protein L28 4932
42 6T7T 62 La 60S ribosomal protein L28 4932
43 6T7I 62 La 60S ribosomal protein L28 4932
44 6T59 26 a3 uL15 9986
45 6T4Q 61 La 60S ribosomal protein L28 4932
46 6SV4 63 AR, XR, zR 60S ribosomal protein L28 4932
47 6SNT 62 ap 60S ribosomal protein L28 4932
48 6SGC 61 a2 Ribosomal_L18e/L15P domain-containing protein 9986
49 6S47 29 Ac 60S ribosomal protein L28 4932
50 6RZZ 13 N 60S ribosomal protein L28 4932
51 6S05 13 N 60S ribosomal protein L28 4932
52 6P5I 64 Aa uL15 9986
53 6P5J 64 Aa uL15 9986
54 6P5K 29 Aa uL15 9986
55 6P5N 29 Aa uL15 9986
56 6RM3 5 LAA uL15 6039
57 6RI5 13 N 60S ribosomal protein L28 MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRY FHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPN VPVIVKARFVSKLAEEKIRAAGGVVELIA 4932
58 6OM7 62 b 60S ribosomal protein L27a 9606
59 6OLZ 31 Aa 60S ribosomal protein L27a 9606
60 6OM0 62 b 60S ribosomal protein L27a 9606
61 6OLE 62 b 60S ribosomal protein L27a 9606
62 6OLF 61 b 60S ribosomal protein L27a 9606
63 6OLG 32 Aa 60S ribosomal protein L27a 9606
64 6OLI 62 b 60S ribosomal protein L27a 9606
65 6R84 37 c 60S ribosomal protein L28 4932
66 6R86 35 c 60S ribosomal protein L28 4932
67 6R87 36 c 60S ribosomal protein L28 4932
68 6R7Q 56 a uL15 9986
69 6R6G 60 a uL15 9986
70 6R6P 29 a uL15 9986
71 6R5Q 32 a uL15 9986
72 6QZP 29 La 60S ribosomal protein L27a 9606
73 6QTZ 13 N 60S ribosomal protein L28 4932
74 6QT0 14 N 60S ribosomal protein L28 4932
75 6QIK 13 N 60S ribosomal protein L28 4932
76 6Q8Y 19 AR 60S ribosomal protein L28 4932
77 6N8J 4 a 60S ribosomal protein L28 4932
78 6N8K 4 a 60S ribosomal protein L28 4932
79 6N8L 4 a 60S ribosomal protein L28 4932
80 6N8M 32 n 60S ribosomal protein L28 4932
81 6N8N 35 n 60S ribosomal protein L28 4932
82 6N8O 37 n 60S ribosomal protein L28 4932
83 6I7O 63 AR, XR 60S ribosomal protein L28 4932
84 6IP5 29 2U 60S ribosomal protein L27a 9606
85 6IP6 29 2U 60S ribosomal protein L27a 9606
86 6IP8 29 2U 60S ribosomal protein L27a 9606
87 6MTB 32 a 60S ribosomal protein L27a 9986
88 6MTC 30 a 60S ribosomal protein L27a 9986
89 6MTD 29 a uL15 9986
90 6MTE 29 a uL15 9986
91 6HD7 32 c 60S ribosomal protein L28 4932
92 6HCQ 62 a3 uL15 9986
93 6HCJ 62 a3 uL15 9986
94 6HCM 61 a3 uL15 9986
95 6HCF 61 a3 uL15 9986
96 6GZ3 66 Aa ribosomal protein uL15 9986
97 6GZ4 66 Aa ribosomal protein uL15 9986
98 6GZ5 66 Aa ribosomal protein uL15 9986
99 6GQV 31 a 60S ribosomal protein L28 4932
100 6GQ1 31 a 60S ribosomal protein L28 4932
101 6GQB 31 a 60S ribosomal protein L28 4932
102 6D9J 26 a uL15 9986
103 6D90 26 a uL15 9986
104 6FTG 26 a uL15 9986
105 6FTI 26 a uL15 9986
106 6FTJ 26 a uL15 9986
107 6FT6 27 a 60S ribosomal protein L28 4932
108 6FRK 34 a Ribosomal protein uL15 9986
109 6ELZ 22 a 60S ribosomal protein L28 4932
110 6EK0 29 La 60S ribosomal protein L27a 9606
111 6AZ3 12 L ribosomal protein uL15 5661
112 5XY3 29 a Uncharacterized protein 5722
113 5XXB 29 Z Ribosomal protein uL15 5811
114 5UMD 15 O 60S ribosomal protein L27a, putative 5833
115 5MC6 58 AR 60S ribosomal protein L28 4932
116 5H4P 28 a 60S ribosomal protein L28 4932
117 5M1J 39 a5 60S ribosomal protein L28 4932
118 5LZS 26 a uL15 9986
119 5LZT 26 a uL15 9986
120 5LZU 26 a uL15 9986
121 5LZV 26 a uL15 9986
122 5LZW 26 a uL15 9986
123 5LZX 26 a uL15 9986
124 5LZY 26 a uL15 9986
125 5LZZ 26 a uL15 9986
126 5T62 30 n 60S ribosomal protein L28 4932
127 5T6R 29 n 60S ribosomal protein L28 4932
128 5T5H 25 b 60S ribosomal protein L27A/L29 5693
129 5T2A 26 Z uL15 5661
130 5T2C 16 U 60S ribosomal protein L27a 9606
131 5LKS 29 La 60S ribosomal protein L27a 9606
132 5JUO 32 FA uL15 (yeast L28) 4932
133 5JUP 32 FA uL15 (yeast L28) 4932
134 5JUS 32 FA uL15 (yeast L28) 4932
135 5JUT 32 FA uL15 (yeast L28) 4932
136 5JUU 32 FA uL15 (yeast L28) 4932
137 5JCS 48 a 60S ribosomal protein L28 4932
138 5IT7 29 aa RPL28 28985
139 3JCT 27 a 60S ribosomal protein L28 4932
140 3JCS 20 L ribosomal protein L15 5661
141 5GAK 12 c 60S ribosomal protein L28 4932
142 5FL8 26 a 60S ribosomal protein L28 4932
143 5APN 29 a 60S ribosomal protein L28 4932
144 5APO 29 a 60S ribosomal protein L28 4932
145 3JBN 60 AO 60S ribosomal protein uL15 5833
146 3JBO 39 AO 60S ribosomal protein uL15 5833
147 3JBP 60 AO 60S ribosomal protein uL15 5833
148 3JAN 19 a Ribosomal protein uL15 SEE REMARK 999 9986
149 3JAJ 19 a Ribosomal protein uL15 SEE REMARK 999 9986
150 3JAG 26 a uL15 9986
151 3JAH 26 a uL15 9986
152 3JAI 26 a uL15 9986
153 4UG0 29 La 60S RIBOSOMAL PROTEIN L27A 9606
154 5AJ0 29 Aa 60S ribosomal protein L27a 9606
155 3J92 26 a uL15 9986
156 4D67 26 a 60S RIBOSOMAL PROTEIN L27A 9986
157 4D5Y 26 a 60S RIBOSOMAL PROTEIN UL15 9986
158 4V3P 43 LO 60S ribosomal protein L27a-3 4565
159 3J7O 29 a Ribosomal protein uL15 9823
160 3J7P 30 a Ribosomal protein uL15 9823
161 3J7Q 29 a Ribosomal protein uL15 9823
162 3J7R 29 a Ribosomal protein uL15 9823
163 4UJC 32 Ba 60S RIBOSOMAL PROTEIN L27A 9986
164 4UJD 29 Aa 60S RIBOSOMAL PROTEIN L27A 9986
165 3J79 15 O 60S ribosomal protein uL15 5833
166 3J77 28 78 60S ribosomal protein L28 4932
167 3J78 28 78 60S ribosomal protein L28 4932
168 3J6X 30 68 60S ribosomal protein L28 4932
169 3J6Y 30 68 60S ribosomal protein L28 4932
170 4UJE 63 Ca 60S RIBOSOMAL PROTEIN L27A 9986
171 4V91 29 a UL15 RIBOSOMAL PROTEIN UL15 28985
172 4V7F 17 N 60S ribosomal protein L28 4932
173 4V7E 46 Ca 60S ribosomal protein L15 4565
174 4V8Y 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
175 4V8Z 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
176 4V4N 59 AL 50S ribosomal protein L15P SEE REMARK 999 2190
177 4V6W 45 Ca 60S ribosomal protein L27a 7227
178 4V6X 45 Ca 60S ribosomal protein L27a 9606
179 4V8M 61 Bb 60S RIBOSOMAL PROTEIN L27A 185431
180 4V6U 35 BL 50S ribosomal protein L15P 2261
181 4V8T 27 a 60S RIBOSOMAL PROTEIN L28 4932
182 4V6I 44 BO 60S ribosomal protein rpL28 (L15p) 4932
183 4V7H 46 BV 60S ribosomal protein L28 5541
184 4V5Z 64 Bl 60S Ribosomal protein L27a 9612
185 4V4B 41 BV 60S ribosomal protein L28 4932