6N8L

Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8L

Entity #1 | Chains: v
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 11 7661
95 % 7 11 8338
90 % 7 11 8375
70 % 7 11 8062
50 % 7 11 7666
40 % 7 11 7372
30 % 7 11 6847
Entity #10 | Chains: E
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 298
95 % 59 102 356
90 % 59 103 369
70 % 61 106 393
50 % 62 107 444
40 % 63 111 456
30 % 63 111 474
Entity #11 | Chains: e
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 265
95 % 60 104 348
90 % 60 104 368
70 % 61 106 395
50 % 85 189 274
40 % 85 193 279
30 % 85 194 287
Entity #12 | Chains: F
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 267
95 % 60 103 352
90 % 60 103 371
70 % 61 105 398
50 % 84 185 284
40 % 84 185 295
30 % 84 184 319
Entity #13 | Chains: f
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 102 274
95 % 59 102 362
90 % 59 102 383
70 % 60 104 408
50 % 82 181 308
40 % 83 183 311
30 % 83 183 328
Entity #14 | Chains: G
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 99 319
95 % 63 106 350
90 % 63 106 375
70 % 64 108 397
50 % 85 169 328
40 % 85 171 333
30 % 85 171 350
Entity #15 | Chains: g
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 300
95 % 59 97 400
90 % 59 97 412
70 % 60 99 430
50 % 82 170 329
40 % 82 170 335
30 % 82 170 354
Entity #16 | Chains: I
Bud site selection protein 20 protein, length: 166 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 20107
95 % 3 5 17740
90 % 3 5 17405
70 % 3 5 16210
50 % 3 5 14640
40 % 3 5 13591
30 % 3 5 12380
Entity #17 | Chains: H
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 102 272
95 % 60 102 357
90 % 60 102 378
70 % 61 104 405
50 % 84 193 270
40 % 152 265 193
30 % 153 266 203
Entity #18 | Chains: h
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 107 253
95 % 60 107 330
90 % 60 107 347
70 % 61 109 387
50 % 84 188 282
40 % 85 199 261
30 % 86 201 268
Entity #19 | Chains: i
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 98 294
95 % 59 102 365
90 % 59 102 386
70 % 60 104 411
50 % 60 104 461
40 % 83 178 316
30 % 83 178 331
Entity #2 | Chains: s
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: j
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 264
95 % 60 104 343
90 % 60 104 366
70 % 70 148 306
50 % 84 193 264
40 % 84 193 276
30 % 84 193 289
Entity #21 | Chains: k
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 303
95 % 59 97 401
90 % 59 97 416
70 % 60 99 437
50 % 60 99 484
40 % 61 106 472
30 % 61 106 493
Entity #22 | Chains: L
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 101 280
95 % 59 101 372
90 % 59 101 390
70 % 60 103 412
50 % 60 103 462
40 % 83 183 303
30 % 83 183 324
Entity #23 | Chains: l
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 101 278
95 % 61 101 363
90 % 61 101 384
70 % 83 176 276
50 % 84 189 273
40 % 84 191 282
30 % 85 192 294
Entity #24 | Chains: M
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 268
95 % 60 103 354
90 % 60 103 372
70 % 61 105 399
50 % 61 105 456
40 % 61 105 484
30 % 61 105 501
Entity #25 | Chains: p
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 94 308
95 % 60 94 406
90 % 60 94 422
70 % 61 96 444
50 % 84 184 285
40 % 85 185 293
30 % 107 208 256
Entity #26 | Chains: N
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 105 262
95 % 62 108 328
90 % 62 108 345
70 % 84 183 265
50 % 86 197 256
40 % 86 197 267
30 % 86 197 281
Entity #27 | Chains: u
Ribosome biogenesis protein RLP24 protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 13 5825
95 % 3 13 6791
90 % 3 13 6804
70 % 3 13 6670
50 % 3 13 6395
40 % 3 13 6188
30 % 3 13 5890
Entity #28 | Chains: O
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 305
95 % 54 95 402
90 % 60 102 377
70 % 61 104 404
50 % 84 185 281
40 % 84 186 291
30 % 84 186 309
Entity #29 | Chains: P
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 106 256
95 % 59 106 334
90 % 60 108 340
70 % 60 108 389
50 % 84 195 259
40 % 84 195 272
30 % 84 195 285
Entity #3 | Chains: A
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 97 292
95 % 60 97 392
90 % 61 99 397
70 % 83 174 278
50 % 84 187 277
40 % 152 258 200
30 % 152 258 210
Entity #30 | Chains: Q
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 266
95 % 60 103 349
90 % 61 105 355
70 % 61 105 396
50 % 83 186 289
40 % 83 191 287
30 % 83 191 305
Entity #31 | Chains: R
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 97 293
95 % 57 97 391
90 % 57 97 408
70 % 58 100 419
50 % 83 185 286
40 % 83 186 297
30 % 83 186 312
Entity #32 | Chains: S
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 101 283
95 % 59 101 377
90 % 60 103 382
70 % 60 103 414
50 % 82 176 319
40 % 83 177 320
30 % 83 178 332
Entity #33 | Chains: T
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 97 295
95 % 60 97 389
90 % 61 99 398
70 % 61 99 423
50 % 83 175 318
40 % 83 181 315
30 % 85 188 303
Entity #34 | Chains: U
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 72 456
95 % 40 72 597
90 % 40 72 629
70 % 41 73 650
50 % 41 73 683
40 % 41 73 715
30 % 42 74 717
Entity #35 | Chains: V
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 263
95 % 60 104 346
90 % 61 106 353
70 % 85 197 240
50 % 85 198 251
40 % 85 198 264
30 % 85 198 274
Entity #36 | Chains: W
Ribosome assembly factor MRT4 protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 11 7834
95 % 3 11 8346
90 % 3 11 8279
70 % 3 11 8070
50 % 3 11 7583
40 % 3 11 7291
30 % 3 11 6854
Entity #37 | Chains: X
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 41 77 425
95 % 41 77 556
90 % 42 78 573
70 % 42 78 599
50 % 42 78 638
40 % 42 80 655
30 % 42 81 669
Entity #38 | Chains: Y
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 108 249
95 % 60 108 324
90 % 61 110 335
70 % 61 110 381
50 % 85 193 266
40 % 85 193 278
30 % 85 193 291
Entity #39 | Chains: y
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 13 31 1882
95 % 13 31 2424
90 % 13 31 2487
70 % 14 32 2477
50 % 16 36 1982
40 % 16 36 2007
30 % 17 38 1879
Entity #4 | Chains: a
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 95 309
95 % 60 98 387
90 % 61 100 393
70 % 61 100 418
50 % 84 188 275
40 % 85 189 284
30 % 85 191 296
Entity #40 | Chains: Z
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 302
95 % 59 97 397
90 % 60 99 403
70 % 60 99 435
50 % 82 171 326
40 % 83 184 298
30 % 84 186 314
Entity #41 | Chains: z
UPF0642 protein YBL028C protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11543
95 % 3 8 12825
90 % 3 8 12037
70 % 3 8 12027
50 % 3 8 10576
40 % 3 8 9983
30 % 3 8 9249
Entity #42 | Chains: D
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 93 316
95 % 60 95 405
90 % 60 95 421
70 % 61 97 442
50 % 84 183 290
40 % 85 185 292
30 % 85 185 311
Entity #43 | Chains: J
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 37 75 483
95 % 60 98 385
90 % 61 100 392
70 % 85 186 257
50 % 87 190 271
40 % 87 190 283
30 % 87 190 298
Entity #44 | Chains: q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 94 307
95 % 60 94 408
90 % 61 96 410
70 % 83 174 279
50 % 85 181 298
40 % 85 182 306
30 % 85 182 326
Entity #45 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 89 329
95 % 59 89 432
90 % 60 91 440
70 % 60 91 466
50 % 60 91 505
40 % 60 91 540
30 % 60 91 566
Entity #46 | Chains: 1
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #47 | Chains: 2
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #48 | Chains: 3
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #5 | Chains: B
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 288
95 % 60 103 355
90 % 61 105 362
70 % 61 105 402
50 % 86 198 250
40 % 86 198 262
30 % 86 200 269
Entity #6 | Chains: b
Nucleolar GTP-binding protein 1 protein, length: 647 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 12 7263
95 % 3 12 7685
90 % 3 12 7568
70 % 3 12 7413
50 % 3 12 7069
40 % 3 12 6984
30 % 3 12 6567
Entity #7 | Chains: C
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 270
95 % 60 107 329
90 % 60 107 346
70 % 61 109 385
50 % 79 157 345
40 % 85 198 263
30 % 85 198 275
Entity #8 | Chains: c
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 103 261
95 % 62 103 341
90 % 63 105 351
70 % 63 105 392
50 % 77 146 363
40 % 77 146 374
30 % 77 146 388
Entity #9 | Chains: d
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 101 276
95 % 60 101 364
90 % 60 101 385
70 % 61 103 410
50 % 84 185 283
40 % 84 185 296
30 % 84 185 316

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 64 Ba, Da 60S ribosomal protein L28 4932
2 4U4R 64 N8, n8 60S ribosomal protein L28 4932
3 4U3U 64 N8, n8 60S ribosomal protein L28 4932
4 5TBW 29 AB, DC 60S ribosomal protein L28 4932
5 4U3M 64 N8, n8 60S ribosomal protein L28 4932
6 4U3N 64 N8, n8 60S ribosomal protein L28 4932
7 4U52 64 N8, n8 60S ribosomal protein L28 4932
8 4U4Q 64 N8, n8 60S ribosomal protein L28 4932
9 4U6F 64 N8, n8 60S ribosomal protein L28 4932
10 4U4U 64 N8, n8 60S ribosomal protein L28 4932
11 4U4Z 64 N8, n8 60S ribosomal protein L28 4932
12 4U4Y 64 N8, n8 60S ribosomal protein L28 4932
13 4U4N 64 N8, n8 60S ribosomal protein L28 4932
14 4U55 64 N8, n8 60S ribosomal protein L28 4932
15 5DAT 64 N8, n8 60S ribosomal protein L28 4932
16 5I4L 64 N8, n8 60S ribosomal protein L28 4932
17 4U51 64 N8, n8 60S ribosomal protein L28 4932
18 6HHQ 29 AB, DC 60S ribosomal protein L28 4932
19 5OBM 29 N8, n8 60S ribosomal protein L28 4932
20 4U53 64 N8, n8 60S ribosomal protein L28 4932
21 5ON6 30 AB, DC 60S ribosomal protein L28 4932
22 4U50 64 N8, n8 60S ribosomal protein L28 4932
23 5NDV 29 N8, n8 60S ribosomal protein L28 4932
24 5LYB 64 N8, n8 60S ribosomal protein L28 4932
25 4U56 64 N8, n8 60S ribosomal protein L28 4932
26 5TGA 64 N8, n8 60S ribosomal protein L28 4932
27 5MEI 30 AB, DC 60S ribosomal protein L28 4932
28 5FCJ 64 N8, n8 60S ribosomal protein L28 4932
29 4U4O 64 N8, n8 60S ribosomal protein L28 4932
30 5DGV 64 N8, n8 60S ribosomal protein L28 4932
31 5DGE 64 N8, n8 60S ribosomal protein L28 4932
32 5NDW 52 N8, n8 60S ribosomal protein L28 4932
33 4V8P 32 BK, CK, EK, GK 60S RIBOSOMAL PROTEIN L27A 5911
34 5NDG 64 N8, n8 60S ribosomal protein L28 4932
35 5FCI 64 N8, n8 60S ribosomal protein L28 4932
36 5DC3 64 N8, n8 60S ribosomal protein L28 4932
37 5DGF 64 N8, n8 60S ribosomal protein L28 4932
38 5TGM 64 N8, n8 60S ribosomal protein L28 4932
39 4V7R 54 BY, DY 60S ribosomal protein L28 4932
40 6Y6X 29 La 60S ribosomal protein L27a 9606
41 6Y57 32 La 60S ribosomal protein L27a 9606
42 6Y2L 32 La 60S ribosomal protein L27a 9606
43 6Y0G 32 La 60S ribosomal protein L27a 9606
44 6TNU 66 AR 60S ribosomal protein L28 4932
45 6UZ7 29 Ba RPL28 28985
46 6TB3 66 AR 60S ribosomal protein L28 4932
47 6T83 62 L, ay 60S ribosomal protein L28 4932
48 6T7T 62 La 60S ribosomal protein L28 4932
49 6T7I 62 La 60S ribosomal protein L28 4932
50 6T59 26 a3 uL15 9986
51 6T4Q 61 La 60S ribosomal protein L28 4932
52 6SV4 63 AR, XR, zR 60S ribosomal protein L28 4932
53 6SNT 62 ap 60S ribosomal protein L28 4932
54 6SGC 61 a2 Ribosomal_L18e/L15P domain-containing protein 9986
55 6S47 29 Ac 60S ribosomal protein L28 4932
56 6RZZ 13 N 60S ribosomal protein L28 4932
57 6S05 13 N 60S ribosomal protein L28 4932
58 6P5I 64 Aa uL15 9986
59 6P5J 64 Aa uL15 9986
60 6P5K 29 Aa uL15 9986
61 6P5N 29 Aa uL15 9986
62 6RM3 5 LAA uL15 6039
63 6RI5 13 N 60S ribosomal protein L28 MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRY FHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPN VPVIVKARFVSKLAEEKIRAAGGVVELIA 4932
64 6OM7 62 b 60S ribosomal protein L27a 9606
65 6OLZ 31 Aa 60S ribosomal protein L27a 9606
66 6OM0 62 b 60S ribosomal protein L27a 9606
67 6OLE 62 b 60S ribosomal protein L27a 9606
68 6OLF 61 b 60S ribosomal protein L27a 9606
69 6OLG 32 Aa 60S ribosomal protein L27a 9606
70 6OLI 62 b 60S ribosomal protein L27a 9606
71 6R84 37 c 60S ribosomal protein L28 4932
72 6R86 35 c 60S ribosomal protein L28 4932
73 6R87 36 c 60S ribosomal protein L28 4932
74 6R7Q 56 a uL15 9986
75 6R6G 60 a uL15 9986
76 6R6P 29 a uL15 9986
77 6R5Q 32 a uL15 9986
78 6QZP 29 La 60S ribosomal protein L27a 9606
79 6QTZ 13 N 60S ribosomal protein L28 4932
80 6QT0 14 N 60S ribosomal protein L28 4932
81 6QIK 13 N 60S ribosomal protein L28 4932
82 6Q8Y 19 AR 60S ribosomal protein L28 4932
83 6N8J 4 a 60S ribosomal protein L28 4932
84 6N8K 4 a 60S ribosomal protein L28 4932
85 6N8L 4 a 60S ribosomal protein L28 4932
86 6N8M 32 n 60S ribosomal protein L28 4932
87 6N8N 35 n 60S ribosomal protein L28 4932
88 6N8O 37 n 60S ribosomal protein L28 4932
89 6I7O 63 AR, XR 60S ribosomal protein L28 4932
90 6IP5 29 2U 60S ribosomal protein L27a 9606
91 6IP6 29 2U 60S ribosomal protein L27a 9606
92 6IP8 29 2U 60S ribosomal protein L27a 9606
93 6MTB 32 a 60S ribosomal protein L27a 9986
94 6MTC 30 a 60S ribosomal protein L27a 9986
95 6MTD 29 a uL15 9986
96 6MTE 29 a uL15 9986
97 6HD7 32 c 60S ribosomal protein L28 4932
98 6HCQ 62 a3 uL15 9986
99 6HCJ 62 a3 uL15 9986
100 6HCM 61 a3 uL15 9986
101 6HCF 61 a3 uL15 9986
102 6GZ3 66 Aa ribosomal protein uL15 9986
103 6GZ4 66 Aa ribosomal protein uL15 9986
104 6GZ5 66 Aa ribosomal protein uL15 9986
105 6GQV 31 a 60S ribosomal protein L28 4932
106 6GQ1 31 a 60S ribosomal protein L28 4932
107 6GQB 31 a 60S ribosomal protein L28 4932
108 6D9J 26 a uL15 9986
109 6D90 26 a uL15 9986
110 6FTG 26 a uL15 9986
111 6FTI 26 a uL15 9986
112 6FTJ 26 a uL15 9986
113 6FT6 27 a 60S ribosomal protein L28 4932
114 6FRK 34 a Ribosomal protein uL15 9986
115 6ELZ 22 a 60S ribosomal protein L28 4932
116 6EK0 29 La 60S ribosomal protein L27a 9606
117 6AZ3 12 L ribosomal protein uL15 5661
118 5XY3 29 a Uncharacterized protein 5722
119 5XXB 29 Z Ribosomal protein uL15 5811
120 5UMD 15 O 60S ribosomal protein L27a, putative 5833
121 5MC6 58 AR 60S ribosomal protein L28 4932
122 5H4P 28 a 60S ribosomal protein L28 4932
123 5M1J 39 a5 60S ribosomal protein L28 4932
124 5LZS 26 a uL15 9986
125 5LZT 26 a uL15 9986
126 5LZU 26 a uL15 9986
127 5LZV 26 a uL15 9986
128 5LZW 26 a uL15 9986
129 5LZX 26 a uL15 9986
130 5LZY 26 a uL15 9986
131 5LZZ 26 a uL15 9986
132 5T62 30 n 60S ribosomal protein L28 4932
133 5T6R 29 n 60S ribosomal protein L28 4932
134 5T5H 25 b 60S ribosomal protein L27A/L29 5693
135 5T2A 26 Z uL15 5661
136 5T2C 16 U 60S ribosomal protein L27a 9606
137 5LKS 29 La 60S ribosomal protein L27a 9606
138 5JUO 32 FA uL15 (yeast L28) 4932
139 5JUP 32 FA uL15 (yeast L28) 4932
140 5JUS 32 FA uL15 (yeast L28) 4932
141 5JUT 32 FA uL15 (yeast L28) 4932
142 5JUU 32 FA uL15 (yeast L28) 4932
143 5JCS 48 a 60S ribosomal protein L28 4932
144 5IT7 29 aa RPL28 28985
145 3JCT 27 a 60S ribosomal protein L28 4932
146 3JCS 20 L ribosomal protein L15 5661
147 5GAK 12 c 60S ribosomal protein L28 4932
148 5FL8 26 a 60S ribosomal protein L28 4932
149 5APN 29 a 60S ribosomal protein L28 4932
150 5APO 29 a 60S ribosomal protein L28 4932
151 3JBN 60 AO 60S ribosomal protein uL15 5833
152 3JBO 39 AO 60S ribosomal protein uL15 5833
153 3JBP 60 AO 60S ribosomal protein uL15 5833
154 3JAN 19 a Ribosomal protein uL15 SEE REMARK 999 9986
155 3JAJ 19 a Ribosomal protein uL15 SEE REMARK 999 9986
156 3JAG 26 a uL15 9986
157 3JAH 26 a uL15 9986
158 3JAI 26 a uL15 9986
159 4UG0 29 La 60S RIBOSOMAL PROTEIN L27A 9606
160 5AJ0 29 Aa 60S ribosomal protein L27a 9606
161 3J92 26 a uL15 9986
162 4D67 26 a 60S RIBOSOMAL PROTEIN L27A 9986
163 4D5Y 26 a 60S RIBOSOMAL PROTEIN UL15 9986
164 4V3P 43 LO 60S ribosomal protein L27a-3 4565
165 3J7O 29 a Ribosomal protein uL15 9823
166 3J7P 30 a Ribosomal protein uL15 9823
167 3J7Q 29 a Ribosomal protein uL15 9823
168 3J7R 29 a Ribosomal protein uL15 9823
169 4UJC 32 Ba 60S RIBOSOMAL PROTEIN L27A 9986
170 4UJD 29 Aa 60S RIBOSOMAL PROTEIN L27A 9986
171 3J79 15 O 60S ribosomal protein uL15 5833
172 3J77 28 78 60S ribosomal protein L28 4932
173 3J78 28 78 60S ribosomal protein L28 4932
174 3J6X 30 68 60S ribosomal protein L28 4932
175 3J6Y 30 68 60S ribosomal protein L28 4932
176 4UJE 63 Ca 60S RIBOSOMAL PROTEIN L27A 9986
177 4V91 29 a UL15 RIBOSOMAL PROTEIN UL15 28985
178 4V7F 17 N 60S ribosomal protein L28 4932
179 4V7E 46 Ca 60S ribosomal protein L15 4565
180 4V8Y 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
181 4V8Z 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
182 4V6W 45 Ca 60S ribosomal protein L27a 7227
183 4V6X 45 Ca 60S ribosomal protein L27a 9606
184 4V8M 61 Bb 60S RIBOSOMAL PROTEIN L27A 185431
185 4V8T 27 a 60S RIBOSOMAL PROTEIN L28 4932
186 4V6I 44 BO 60S ribosomal protein rpL28 (L15p) 4932
187 4V7H 46 BV 60S ribosomal protein L28 5541
188 4V5Z 64 Bl 60S Ribosomal protein L27a 9612
189 4V4B 41 BV 60S ribosomal protein L28 4932