6N8L

Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8L

Entity #1 | Chains: v
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 11 7567
95 % 7 11 8076
90 % 7 11 8021
70 % 7 11 7811
50 % 7 11 7350
40 % 7 11 7076
30 % 7 11 6651
Entity #10 | Chains: E
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 275
95 % 57 100 350
90 % 57 101 361
70 % 59 104 382
50 % 60 105 439
40 % 61 109 452
30 % 61 109 472
Entity #11 | Chains: e
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 102 250
95 % 58 102 336
90 % 58 102 355
70 % 59 104 383
50 % 79 183 267
40 % 79 187 270
30 % 79 188 284
Entity #12 | Chains: F
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 259
95 % 58 101 348
90 % 58 101 365
70 % 59 103 391
50 % 78 179 280
40 % 78 179 292
30 % 78 178 320
Entity #13 | Chains: f
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 100 263
95 % 57 100 361
90 % 57 100 376
70 % 58 102 400
50 % 76 175 304
40 % 77 177 308
30 % 77 177 330
Entity #14 | Chains: G
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 309
95 % 61 104 345
90 % 61 104 362
70 % 62 106 388
50 % 79 163 331
40 % 79 165 339
30 % 79 165 357
Entity #15 | Chains: g
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 95 286
95 % 57 95 381
90 % 57 95 400
70 % 58 97 418
50 % 76 164 328
40 % 76 164 342
30 % 76 164 358
Entity #16 | Chains: I
Bud site selection protein 20 protein, length: 166 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 19096
95 % 3 5 18611
90 % 3 5 18280
70 % 3 5 17006
50 % 3 5 15271
40 % 3 5 14190
30 % 3 5 12916
Entity #17 | Chains: H
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 100 262
95 % 58 100 353
90 % 58 100 370
70 % 59 102 396
50 % 78 187 263
40 % 79 189 265
30 % 147 260 202
Entity #18 | Chains: h
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 105 244
95 % 58 105 324
90 % 58 105 340
70 % 59 107 376
50 % 78 182 278
40 % 79 193 254
30 % 80 195 266
Entity #19 | Chains: i
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 96 280
95 % 57 100 356
90 % 57 100 373
70 % 58 102 398
50 % 58 102 455
40 % 77 172 311
30 % 77 172 337
Entity #2 | Chains: s
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: j
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 102 254
95 % 58 102 339
90 % 58 102 357
70 % 65 143 307
50 % 78 187 257
40 % 78 187 271
30 % 78 187 287
Entity #21 | Chains: k
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 95 288
95 % 57 95 386
90 % 57 95 401
70 % 58 97 421
50 % 58 97 472
40 % 59 104 469
30 % 59 104 483
Entity #22 | Chains: L
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 99 270
95 % 57 99 365
90 % 57 99 381
70 % 58 101 403
50 % 58 101 458
40 % 77 177 300
30 % 77 177 325
Entity #23 | Chains: l
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 99 265
95 % 59 99 358
90 % 59 99 372
70 % 77 171 270
50 % 78 183 265
40 % 78 185 274
30 % 79 186 294
Entity #24 | Chains: M
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 260
95 % 58 101 347
90 % 58 101 363
70 % 59 103 390
50 % 59 103 450
40 % 59 103 476
30 % 59 103 491
Entity #25 | Chains: p
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 92 299
95 % 58 92 394
90 % 58 92 408
70 % 59 94 429
50 % 78 178 283
40 % 79 179 291
30 % 101 202 253
Entity #26 | Chains: N
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 103 253
95 % 60 106 322
90 % 60 106 337
70 % 78 177 262
50 % 80 191 249
40 % 80 191 262
30 % 80 191 276
Entity #27 | Chains: u
Ribosome biogenesis protein RLP24 protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 13 5823
95 % 3 13 6610
90 % 3 13 6622
70 % 3 13 6541
50 % 3 13 6243
40 % 3 13 6061
30 % 3 13 5781
Entity #28 | Chains: O
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 93 291
95 % 52 93 389
90 % 58 100 366
70 % 59 102 392
50 % 78 179 276
40 % 78 180 284
30 % 78 180 312
Entity #29 | Chains: P
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 104 246
95 % 57 104 331
90 % 58 106 334
70 % 58 106 377
50 % 78 189 251
40 % 78 189 266
30 % 78 189 281
Entity #3 | Chains: A
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 95 281
95 % 58 95 377
90 % 59 97 385
70 % 77 168 273
50 % 78 181 273
40 % 146 252 198
30 % 146 252 208
Entity #30 | Chains: Q
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 257
95 % 58 101 344
90 % 59 103 352
70 % 59 103 387
50 % 77 180 287
40 % 77 185 282
30 % 77 185 308
Entity #31 | Chains: R
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 55 95 282
95 % 55 95 376
90 % 55 95 393
70 % 56 98 408
50 % 77 179 282
40 % 77 180 289
30 % 77 180 316
Entity #32 | Chains: S
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 99 274
95 % 57 99 364
90 % 58 101 369
70 % 58 101 402
50 % 76 170 316
40 % 77 171 318
30 % 77 172 339
Entity #33 | Chains: T
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 95 284
95 % 58 95 379
90 % 59 97 382
70 % 59 97 415
50 % 77 169 313
40 % 77 175 310
30 % 79 182 310
Entity #34 | Chains: U
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 72 433
95 % 40 72 572
90 % 40 72 599
70 % 41 73 614
50 % 41 73 659
40 % 41 73 692
30 % 42 74 691
Entity #35 | Chains: V
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 102 251
95 % 58 102 338
90 % 59 104 346
70 % 79 191 227
50 % 79 192 245
40 % 79 192 258
30 % 79 192 272
Entity #36 | Chains: W
Ribosome assembly factor MRT4 protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 11 7627
95 % 3 11 8199
90 % 3 11 8140
70 % 3 11 7929
50 % 3 11 7455
40 % 3 11 7188
30 % 3 11 6746
Entity #37 | Chains: X
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 41 77 399
95 % 41 77 528
90 % 42 78 543
70 % 42 78 574
50 % 42 78 616
40 % 42 80 630
30 % 42 81 645
Entity #38 | Chains: Y
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 106 242
95 % 58 106 319
90 % 59 108 326
70 % 59 108 372
50 % 79 190 247
40 % 79 190 260
30 % 79 190 275
Entity #39 | Chains: y
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 13 31 1791
95 % 13 31 2341
90 % 13 31 2393
70 % 14 32 2381
50 % 16 36 1911
40 % 16 36 1948
30 % 17 38 1836
Entity #4 | Chains: a
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 93 297
95 % 58 96 373
90 % 59 98 377
70 % 59 98 406
50 % 78 182 271
40 % 79 183 276
30 % 79 185 296
Entity #40 | Chains: Z
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 95 287
95 % 57 95 385
90 % 58 97 388
70 % 58 97 420
50 % 76 165 326
40 % 77 178 295
30 % 78 180 317
Entity #41 | Chains: z
UPF0642 protein YBL028C protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 10852
95 % 3 8 11955
90 % 3 8 11807
70 % 3 8 11274
50 % 3 8 10340
40 % 3 8 9906
30 % 3 8 9168
Entity #42 | Chains: D
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 91 304
95 % 58 93 390
90 % 58 93 404
70 % 59 95 427
50 % 78 177 286
40 % 79 179 288
30 % 79 179 314
Entity #43 | Chains: J
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 35 73 475
95 % 58 96 372
90 % 59 98 380
70 % 79 180 252
50 % 81 184 261
40 % 81 184 275
30 % 81 184 299
Entity #44 | Chains: q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 92 296
95 % 58 92 393
90 % 59 94 395
70 % 77 168 277
50 % 79 175 296
40 % 79 176 302
30 % 79 176 327
Entity #45 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 87 315
95 % 57 87 423
90 % 58 89 434
70 % 58 89 462
50 % 58 89 496
40 % 58 89 531
30 % 58 89 552
Entity #46 | Chains: 1
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #47 | Chains: 2
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #48 | Chains: 3
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #5 | Chains: B
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 99 276
95 % 58 101 346
90 % 59 103 351
70 % 59 103 389
50 % 80 192 244
40 % 80 192 256
30 % 80 194 268
Entity #6 | Chains: b
Nucleolar GTP-binding protein 1 protein, length: 647 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 12 6668
95 % 3 12 6780
90 % 3 12 6798
70 % 3 12 6697
50 % 3 12 6395
40 % 3 12 6211
30 % 3 12 5906
Entity #7 | Chains: C
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 256
95 % 58 105 321
90 % 58 105 336
70 % 59 107 374
50 % 76 154 341
40 % 79 192 257
30 % 79 192 270
Entity #8 | Chains: c
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 101 255
95 % 60 101 341
90 % 61 103 348
70 % 61 103 385
50 % 74 143 355
40 % 74 143 368
30 % 74 143 386
Entity #9 | Chains: d
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 99 266
95 % 58 99 359
90 % 58 99 375
70 % 59 101 399
50 % 78 179 281
40 % 78 179 293
30 % 78 179 318

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 40 BB, DB 60S ribosomal protein L3 4932
2 4U4R 40 L3, l3 60S ribosomal protein L3 4932
3 4U3U 40 L3, l3 60S ribosomal protein L3 4932
4 5TBW 5 CE, k 60S ribosomal protein L3 4932
5 4U3M 40 L3, l3 60S ribosomal protein L3 4932
6 4U3N 40 L3, l3 60S ribosomal protein L3 4932
7 4U52 40 L3, l3 60S ribosomal protein L3 4932
8 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
9 4U6F 40 L3, l3 60S ribosomal protein L3 4932
10 4U4U 40 L3, l3 60S ribosomal protein L3 4932
11 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
12 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
13 4U4N 40 L3, l3 60S ribosomal protein L3 4932
14 4U55 40 L3, l3 60S ribosomal protein L3 4932
15 5DAT 40 L3, l3 60S ribosomal protein L3 4932
16 5I4L 40 L3, l3 60S ribosomal protein L3 4932
17 4U51 40 L3, l3 60S ribosomal protein L3 4932
18 6HHQ 5 CE, k 60S ribosomal protein L3 4932
19 5OBM 5 L3, l3 60S ribosomal protein L3 4932
20 4U53 40 L3, l3 60S ribosomal protein L3 4932
21 5ON6 5 CE, k 60S ribosomal protein L3 4932
22 4U50 40 L3, l3 60S ribosomal protein L3 4932
23 5NDV 5 L3, l3 60S ribosomal protein L3 4932
24 5LYB 40 L3, l3 60S ribosomal protein L3 4932
25 4U56 40 L3, l3 60S ribosomal protein L3 4932
26 5TGA 40 L3, l3 60S ribosomal protein L3 4932
27 5MEI 5 CE, k 60S ribosomal protein L3 4932
28 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
29 4U4O 40 L3, l3 60S ribosomal protein L3 4932
30 5DGV 40 L3, l3 60S ribosomal protein L3 4932
31 5DGE 40 L3, l3 60S ribosomal protein L3 4932
32 5NDW 28 L3, l3 60S ribosomal protein L3 4932
33 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
34 5NDG 40 L3, l3 60S ribosomal protein L3 4932
35 5FCI 40 L3, l3 60S ribosomal protein L3 4932
36 5DC3 40 L3, l3 60S ribosomal protein L3 4932
37 5DGF 40 L3, l3 60S ribosomal protein L3 4932
38 5TGM 40 L3, l3 60S ribosomal protein L3 4932
39 4V7R 34 BC, DC 60S ribosomal protein L3 4932
40 6UZ7 5 AB 60S ribosomal protein L3 28985
41 6T83 38 By, Ea 60S ribosomal protein L3 4932
42 6T7T 3 LB 60S ribosomal protein L3 4932
43 6T7I 38 LB 60S ribosomal protein L3 4932
44 6T59 2 B3 uL3 9986
45 6T4Q 37 LB 60S ribosomal protein L3 4932
46 6SV4 5 BA, YA, ZA 60S ribosomal protein L3 4932
47 6SNT 38 i 60S ribosomal protein L3 4932
48 6SGC 37 B2 uL3 9986
49 6S47 5 AE 60S ribosomal protein L3 4932
50 6RZZ 3 C 60S ribosomal protein L3 4932
51 6S05 3 C 60S ribosomal protein L3 4932
52 6P5I 40 AB uL3 9986
53 6P5J 40 AB uL3 9986
54 6P5K 5 AB uL3 9986
55 6P5N 5 AB uL3 9986
56 6RM3 7 LB0 uL3 6039
57 6RI5 3 C 60S ribosomal protein L3 4932
58 6OM7 36 B 60S ribosomal protein L3 9606
59 6OLZ 3 AB 60S ribosomal protein L3 9606
60 6OM0 36 B 60S ribosomal protein L3 9606
61 6OLE 36 B 60S ribosomal protein L3 9606
62 6OLF 36 B 60S ribosomal protein L3 9606
63 6OLG 3 AB 60S ribosomal protein L3 9606
64 6OLI 36 B 60S ribosomal protein L3 9606
65 6R84 42 F 60S ribosomal protein L3 4932
66 6R86 40 F 60S ribosomal protein L3 4932
67 6R87 41 F 60S ribosomal protein L3 4932
68 6R7Q 30 B uL3 9986
69 6R6G 13 B uL3 9986
70 6R6P 5 B uL3 9986
71 6R5Q 8 B uL3 9986
72 6QZP 5 LB 60S ribosomal protein L3 9606
73 6QTZ 3 C 60S ribosomal protein L3 4932
74 6QT0 3 C 60S ribosomal protein L3 4932
75 6QKL 2 A 60S ribosomal protein L3 44689
76 6QIK 3 C 60S ribosomal protein L3 4932
77 6Q8Y 38 BA 60S ribosomal protein L3 4932
78 6N8J 5 B 60S ribosomal protein L3 4932
79 6N8K 5 B 60S ribosomal protein L3 4932
80 6N8L 5 B 60S ribosomal protein L3 4932
81 6N8M 6 E 60S ribosomal protein L3 4932
82 6N8N 9 E 60S ribosomal protein L3 4932
83 6N8O 10 E 60S ribosomal protein L3 4932
84 6I7O 5 BA, YA 60S ribosomal protein L3 4932
85 6IP5 5 1E 60S ribosomal protein L3 9606
86 6IP6 5 1E 60S ribosomal protein L3 9606
87 6IP8 5 1E 60S ribosomal protein L3 9606
88 6MTB 8 B 60S ribosomal protein L3 9986
89 6MTC 6 B 60S ribosomal protein L3 9986
90 6MTD 5 B uL3 9986
91 6MTE 5 B uL3 9986
92 6HD7 9 F 60S ribosomal protein L3 4932
93 6HCQ 39 B3 uL3 9986
94 6HCJ 39 B3 uL3 9986
95 6HCM 41 B3 uL3 9986
96 6HCF 41 B3 uL3 9986
97 6GZ3 42 AB ribosomal protein uL3 9986
98 6GZ4 3 AB ribosomal protein uL3 9986
99 6GZ5 42 AB ribosomal protein uL3 9986
100 6GQV 7 B 60S ribosomal protein L3 4932
101 6GQ1 7 B 60S ribosomal protein L3 4932
102 6GQB 7 B 60S ribosomal protein L3 4932
103 6D9J 2 B uL3 9986
104 6D90 2 B uL3 9986
105 6FTG 2 B uL3 9986
106 6FTI 2 B uL3 9986
107 6FTJ 2 B uL3 9986
108 6FT6 3 B 60S ribosomal protein L3 4932
109 6FRK 10 B Ribosomal protein uL3 9986
110 5Z3G 6 F 60S ribosomal protein L3 4932
111 6C0F 5 B 60S ribosomal protein L3 4932
112 6EM1 16 B 60S ribosomal protein L3 4932
113 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
114 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
115 6ELZ 28 B 60S ribosomal protein L3 4932
116 6EK0 5 LB 60S ribosomal protein L3 9606
117 6AZ3 2 B ribosomal protein uL3 5661
118 5XY3 5 B Uncharacterized protein 5722
119 5XXB 5 B Ribosomal protein uL3 5811
120 5UMD 5 E 60S ribosomal protein L3 5833
121 5MC6 67 BA 60S ribosomal protein L3 4932
122 5H4P 5 B 60S ribosomal protein L3 4932
123 5M1J 42 B5 60S ribosomal protein L3 4932
124 5LZS 2 B uL3 9986
125 5LZT 2 B uL3 9986
126 5LZU 2 B uL3 9986
127 5LZV 2 B uL3 9986
128 5LZW 2 B uL3 9986
129 5LZX 2 B Ul3 9986
130 5LZY 2 B uL3 9986
131 5LZZ 2 B uL3 9986
132 5T62 6 E 60S ribosomal protein L3 4932
133 5T6R 5 E 60S ribosomal protein L3 4932
134 5T5H 29 f Ribosomal protein L13 5693
135 5T2A 30 d uL3 5661
136 5T2C 4 E 60S ribosomal protein L3 9606
137 5LKS 5 LB 60S ribosomal protein L3 9606
138 5JUO 7 G uL3 (yeast L3) 4932
139 5JUP 7 G uL3 (yeast L3) 4932
140 5JUS 7 G uL3 (yeast L3) 4932
141 5JUT 7 G uL3 (yeast L3) 4932
142 5JUU 7 G uL3 (yeast L3) 4932
143 5JCS 3 B 60S ribosomal protein L3 4932
144 5IT7 5 BB 60S ribosomal protein L3 28985
145 3JCT 2 B 60S ribosomal protein L3 4932
146 3JCS 10 B ribosomal protein L3 5661
147 5GAK 17 F 60S ribosomal protein L3 4932
148 5FL8 2 B 60S ribosomal protein L3 4932
149 5APN 5 B 60S ribosomal protein L3 4932
150 5APO 5 B 60S ribosomal protein L3 4932
151 3JBN 70 AE 60S ribosomal protein uL3 5833
152 3JBO 70 AE 60S ribosomal protein uL3 5833
153 3JBP 70 AE 60S ribosomal protein uL3 5833
154 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
155 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
156 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
157 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
158 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
159 3JAG 2 B uL3 9986
160 3JAH 2 B uL3 9986
161 3JAI 2 B uL3 9986
162 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
163 5AJ0 4 AB 60S ribosomal protein L3 9606
164 3J92 2 B uL3 9986
165 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
166 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
167 4V3P 80 LC Ribosomal protein L3 4565
168 3J7O 5 B Ribosomal protein uL3 9823
169 3J7P 5 B Ribosomal protein uL3 9823
170 3J7Q 5 B Ribosomal protein uL3 9823
171 3J7R 5 B Ribosomal protein uL3 9823
172 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
173 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
174 3J79 5 E 60S ribosomal protein uL3 5833
175 3J77 3 L3 60S ribosomal protein L3 4932
176 3J78 3 L3 60S ribosomal protein L3 4932
177 3J6X 6 L3 60S ribosomal protein L3 4932
178 3J6Y 6 L3 60S ribosomal protein L3 4932
179 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
180 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
181 4V7F 6 C 60S ribosomal protein L3 4932
182 4V7E 71 CB 60S ribosomal protein L3 4565
183 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
184 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
185 4V6W 63 CB 60S ribosomal protein L3 7227
186 4V6X 63 CB 60S ribosomal protein L3 9606
187 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
188 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
189 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
190 4V7H 27 BC 60S ribosomal protein L3 5541
191 4V5Z 54 Bb 60S Ribosomal protein L3 9612
192 4V4B 22 BC 60S ribosomal protein L3 4932