6N8L

Cryo-EM structure of early cytoplasmic-late (ECL) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8L

Entity #1 | Chains: v
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 7 11 7661
95 % 7 11 8338
90 % 7 11 8375
70 % 7 11 8062
50 % 7 11 7666
40 % 7 11 7372
30 % 7 11 6847
Entity #10 | Chains: E
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 298
95 % 59 102 356
90 % 59 103 369
70 % 61 106 393
50 % 62 107 444
40 % 63 111 456
30 % 63 111 474
Entity #11 | Chains: e
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 265
95 % 60 104 348
90 % 60 104 368
70 % 61 106 395
50 % 85 189 274
40 % 85 193 279
30 % 85 194 287
Entity #12 | Chains: F
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 267
95 % 60 103 352
90 % 60 103 371
70 % 61 105 398
50 % 84 185 284
40 % 84 185 295
30 % 84 184 319
Entity #13 | Chains: f
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 102 274
95 % 59 102 362
90 % 59 102 383
70 % 60 104 408
50 % 82 181 308
40 % 83 183 311
30 % 83 183 328
Entity #14 | Chains: G
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 99 319
95 % 63 106 350
90 % 63 106 375
70 % 64 108 397
50 % 85 169 328
40 % 85 171 333
30 % 85 171 350
Entity #15 | Chains: g
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 300
95 % 59 97 400
90 % 59 97 412
70 % 60 99 430
50 % 82 170 329
40 % 82 170 335
30 % 82 170 354
Entity #16 | Chains: I
Bud site selection protein 20 protein, length: 166 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 5 20107
95 % 3 5 17740
90 % 3 5 17405
70 % 3 5 16210
50 % 3 5 14640
40 % 3 5 13591
30 % 3 5 12380
Entity #17 | Chains: H
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 102 272
95 % 60 102 357
90 % 60 102 378
70 % 61 104 405
50 % 84 193 270
40 % 152 265 193
30 % 153 266 203
Entity #18 | Chains: h
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 107 253
95 % 60 107 330
90 % 60 107 347
70 % 61 109 387
50 % 84 188 282
40 % 85 199 261
30 % 86 201 268
Entity #19 | Chains: i
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 98 294
95 % 59 102 365
90 % 59 102 386
70 % 60 104 411
50 % 60 104 461
40 % 83 178 316
30 % 83 178 331
Entity #2 | Chains: s
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: j
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 264
95 % 60 104 343
90 % 60 104 366
70 % 70 148 306
50 % 84 193 264
40 % 84 193 276
30 % 84 193 289
Entity #21 | Chains: k
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 303
95 % 59 97 401
90 % 59 97 416
70 % 60 99 437
50 % 60 99 484
40 % 61 106 472
30 % 61 106 493
Entity #22 | Chains: L
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 101 280
95 % 59 101 372
90 % 59 101 390
70 % 60 103 412
50 % 60 103 462
40 % 83 183 303
30 % 83 183 324
Entity #23 | Chains: l
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 101 278
95 % 61 101 363
90 % 61 101 384
70 % 83 176 276
50 % 84 189 273
40 % 84 191 282
30 % 85 192 294
Entity #24 | Chains: M
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 268
95 % 60 103 354
90 % 60 103 372
70 % 61 105 399
50 % 61 105 456
40 % 61 105 484
30 % 61 105 501
Entity #25 | Chains: p
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 94 308
95 % 60 94 406
90 % 60 94 422
70 % 61 96 444
50 % 84 184 285
40 % 85 185 293
30 % 107 208 256
Entity #26 | Chains: N
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 105 262
95 % 62 108 328
90 % 62 108 345
70 % 84 183 265
50 % 86 197 256
40 % 86 197 267
30 % 86 197 281
Entity #27 | Chains: u
Ribosome biogenesis protein RLP24 protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 13 5825
95 % 3 13 6791
90 % 3 13 6804
70 % 3 13 6670
50 % 3 13 6395
40 % 3 13 6188
30 % 3 13 5890
Entity #28 | Chains: O
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 305
95 % 54 95 402
90 % 60 102 377
70 % 61 104 404
50 % 84 185 281
40 % 84 186 291
30 % 84 186 309
Entity #29 | Chains: P
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 106 256
95 % 59 106 334
90 % 60 108 340
70 % 60 108 389
50 % 84 195 259
40 % 84 195 272
30 % 84 195 285
Entity #3 | Chains: A
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 97 292
95 % 60 97 392
90 % 61 99 397
70 % 83 174 278
50 % 84 187 277
40 % 152 258 200
30 % 152 258 210
Entity #30 | Chains: Q
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 266
95 % 60 103 349
90 % 61 105 355
70 % 61 105 396
50 % 83 186 289
40 % 83 191 287
30 % 83 191 305
Entity #31 | Chains: R
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 57 97 293
95 % 57 97 391
90 % 57 97 408
70 % 58 100 419
50 % 83 185 286
40 % 83 186 297
30 % 83 186 312
Entity #32 | Chains: S
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 101 283
95 % 59 101 377
90 % 60 103 382
70 % 60 103 414
50 % 82 176 319
40 % 83 177 320
30 % 83 178 332
Entity #33 | Chains: T
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 97 295
95 % 60 97 389
90 % 61 99 398
70 % 61 99 423
50 % 83 175 318
40 % 83 181 315
30 % 85 188 303
Entity #34 | Chains: U
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 72 456
95 % 40 72 597
90 % 40 72 629
70 % 41 73 650
50 % 41 73 683
40 % 41 73 715
30 % 42 74 717
Entity #35 | Chains: V
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 104 263
95 % 60 104 346
90 % 61 106 353
70 % 85 197 240
50 % 85 198 251
40 % 85 198 264
30 % 85 198 274
Entity #36 | Chains: W
Ribosome assembly factor MRT4 protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 11 7834
95 % 3 11 8346
90 % 3 11 8279
70 % 3 11 8070
50 % 3 11 7583
40 % 3 11 7291
30 % 3 11 6854
Entity #37 | Chains: X
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 41 77 425
95 % 41 77 556
90 % 42 78 573
70 % 42 78 599
50 % 42 78 638
40 % 42 80 655
30 % 42 81 669
Entity #38 | Chains: Y
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 108 249
95 % 60 108 324
90 % 61 110 335
70 % 61 110 381
50 % 85 193 266
40 % 85 193 278
30 % 85 193 291
Entity #39 | Chains: y
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 13 31 1882
95 % 13 31 2424
90 % 13 31 2487
70 % 14 32 2477
50 % 16 36 1982
40 % 16 36 2007
30 % 17 38 1879
Entity #4 | Chains: a
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 95 309
95 % 60 98 387
90 % 61 100 393
70 % 61 100 418
50 % 84 188 275
40 % 85 189 284
30 % 85 191 296
Entity #40 | Chains: Z
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 302
95 % 59 97 397
90 % 60 99 403
70 % 60 99 435
50 % 82 171 326
40 % 83 184 298
30 % 84 186 314
Entity #41 | Chains: z
UPF0642 protein YBL028C protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 8 11543
95 % 3 8 12825
90 % 3 8 12037
70 % 3 8 12027
50 % 3 8 10576
40 % 3 8 9983
30 % 3 8 9249
Entity #42 | Chains: D
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 93 316
95 % 60 95 405
90 % 60 95 421
70 % 61 97 442
50 % 84 183 290
40 % 85 185 292
30 % 85 185 311
Entity #43 | Chains: J
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 37 75 483
95 % 60 98 385
90 % 61 100 392
70 % 85 186 257
50 % 87 190 271
40 % 87 190 283
30 % 87 190 298
Entity #44 | Chains: q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 94 307
95 % 60 94 408
90 % 61 96 410
70 % 83 174 279
50 % 85 181 298
40 % 85 182 306
30 % 85 182 326
Entity #45 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 89 329
95 % 59 89 432
90 % 60 91 440
70 % 60 91 466
50 % 60 91 505
40 % 60 91 540
30 % 60 91 566
Entity #46 | Chains: 1
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #47 | Chains: 2
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #48 | Chains: 3
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #5 | Chains: B
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 101 288
95 % 60 103 355
90 % 61 105 362
70 % 61 105 402
50 % 86 198 250
40 % 86 198 262
30 % 86 200 269
Entity #6 | Chains: b
Nucleolar GTP-binding protein 1 protein, length: 647 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 12 7263
95 % 3 12 7685
90 % 3 12 7568
70 % 3 12 7413
50 % 3 12 7069
40 % 3 12 6984
30 % 3 12 6567
Entity #7 | Chains: C
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 103 270
95 % 60 107 329
90 % 60 107 346
70 % 61 109 385
50 % 79 157 345
40 % 85 198 263
30 % 85 198 275
Entity #8 | Chains: c
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 103 261
95 % 62 103 341
90 % 63 105 351
70 % 63 105 392
50 % 77 146 363
40 % 77 146 374
30 % 77 146 388
Entity #9 | Chains: d
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 101 276
95 % 60 101 364
90 % 60 101 385
70 % 61 103 410
50 % 84 185 283
40 % 84 185 296
30 % 84 185 316

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 40 BB, DB 60S ribosomal protein L3 4932
2 4U4R 40 L3, l3 60S ribosomal protein L3 4932
3 4U3U 40 L3, l3 60S ribosomal protein L3 4932
4 5TBW 5 CE, k 60S ribosomal protein L3 4932
5 4U3M 40 L3, l3 60S ribosomal protein L3 4932
6 4U3N 40 L3, l3 60S ribosomal protein L3 4932
7 4U52 40 L3, l3 60S ribosomal protein L3 4932
8 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
9 4U6F 40 L3, l3 60S ribosomal protein L3 4932
10 4U4U 40 L3, l3 60S ribosomal protein L3 4932
11 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
12 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
13 4U4N 40 L3, l3 60S ribosomal protein L3 4932
14 4U55 40 L3, l3 60S ribosomal protein L3 4932
15 5DAT 40 L3, l3 60S ribosomal protein L3 4932
16 5I4L 40 L3, l3 60S ribosomal protein L3 4932
17 4U51 40 L3, l3 60S ribosomal protein L3 4932
18 6HHQ 5 CE, k 60S ribosomal protein L3 4932
19 5OBM 5 L3, l3 60S ribosomal protein L3 4932
20 4U53 40 L3, l3 60S ribosomal protein L3 4932
21 5ON6 5 CE, k 60S ribosomal protein L3 4932
22 4U50 40 L3, l3 60S ribosomal protein L3 4932
23 5NDV 5 L3, l3 60S ribosomal protein L3 4932
24 5LYB 40 L3, l3 60S ribosomal protein L3 4932
25 4U56 40 L3, l3 60S ribosomal protein L3 4932
26 5TGA 40 L3, l3 60S ribosomal protein L3 4932
27 5MEI 5 CE, k 60S ribosomal protein L3 4932
28 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
29 4U4O 40 L3, l3 60S ribosomal protein L3 4932
30 5DGV 40 L3, l3 60S ribosomal protein L3 4932
31 5DGE 40 L3, l3 60S ribosomal protein L3 4932
32 5NDW 28 L3, l3 60S ribosomal protein L3 4932
33 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
34 5NDG 40 L3, l3 60S ribosomal protein L3 4932
35 5FCI 40 L3, l3 60S ribosomal protein L3 4932
36 5DC3 40 L3, l3 60S ribosomal protein L3 4932
37 5DGF 40 L3, l3 60S ribosomal protein L3 4932
38 5TGM 40 L3, l3 60S ribosomal protein L3 4932
39 4V7R 34 BC, DC 60S ribosomal protein L3 4932
40 6Y6X 5 LB 60S ribosomal protein L3 9606
41 6Y57 8 LB 60S ribosomal protein L3 9606
42 6Y2L 8 LB 60S ribosomal protein L3 9606
43 6Y0G 8 LB 60S ribosomal protein L3 9606
44 6TNU 42 BA 60S ribosomal protein L3 4932
45 6UZ7 5 AB 60S ribosomal protein L3 28985
46 6TB3 42 BA 60S ribosomal protein L3 4932
47 6T83 38 By, Ea 60S ribosomal protein L3 4932
48 6T7T 3 LB 60S ribosomal protein L3 4932
49 6T7I 38 LB 60S ribosomal protein L3 4932
50 6T59 2 B3 uL3 9986
51 6T4Q 37 LB 60S ribosomal protein L3 4932
52 6SV4 5 BA, YA, ZA 60S ribosomal protein L3 4932
53 6SNT 38 i 60S ribosomal protein L3 4932
54 6SGC 37 B2 uL3 9986
55 6S47 5 AE 60S ribosomal protein L3 4932
56 6RZZ 3 C 60S ribosomal protein L3 4932
57 6S05 3 C 60S ribosomal protein L3 4932
58 6P5I 40 AB uL3 9986
59 6P5J 40 AB uL3 9986
60 6P5K 5 AB uL3 9986
61 6P5N 5 AB uL3 9986
62 6RM3 7 LB0 uL3 6039
63 6RI5 3 C 60S ribosomal protein L3 4932
64 6OM7 36 B 60S ribosomal protein L3 9606
65 6OLZ 3 AB 60S ribosomal protein L3 9606
66 6OM0 36 B 60S ribosomal protein L3 9606
67 6OLE 36 B 60S ribosomal protein L3 9606
68 6OLF 36 B 60S ribosomal protein L3 9606
69 6OLG 3 AB 60S ribosomal protein L3 9606
70 6OLI 36 B 60S ribosomal protein L3 9606
71 6R84 42 F 60S ribosomal protein L3 4932
72 6R86 40 F 60S ribosomal protein L3 4932
73 6R87 41 F 60S ribosomal protein L3 4932
74 6R7Q 30 B uL3 9986
75 6R6G 13 B uL3 9986
76 6R6P 5 B uL3 9986
77 6R5Q 8 B uL3 9986
78 6QZP 5 LB 60S ribosomal protein L3 9606
79 6QTZ 3 C 60S ribosomal protein L3 4932
80 6QT0 3 C 60S ribosomal protein L3 4932
81 6QKL 2 A 60S ribosomal protein L3 44689
82 6QIK 3 C 60S ribosomal protein L3 4932
83 6Q8Y 38 BA 60S ribosomal protein L3 4932
84 6N8J 5 B 60S ribosomal protein L3 4932
85 6N8K 5 B 60S ribosomal protein L3 4932
86 6N8L 5 B 60S ribosomal protein L3 4932
87 6N8M 6 E 60S ribosomal protein L3 4932
88 6N8N 9 E 60S ribosomal protein L3 4932
89 6N8O 10 E 60S ribosomal protein L3 4932
90 6I7O 5 BA, YA 60S ribosomal protein L3 4932
91 6IP5 5 1E 60S ribosomal protein L3 9606
92 6IP6 5 1E 60S ribosomal protein L3 9606
93 6IP8 5 1E 60S ribosomal protein L3 9606
94 6MTB 8 B 60S ribosomal protein L3 9986
95 6MTC 6 B 60S ribosomal protein L3 9986
96 6MTD 5 B uL3 9986
97 6MTE 5 B uL3 9986
98 6HD7 9 F 60S ribosomal protein L3 4932
99 6HCQ 39 B3 uL3 9986
100 6HCJ 39 B3 uL3 9986
101 6HCM 41 B3 uL3 9986
102 6HCF 41 B3 uL3 9986
103 6GZ3 42 AB ribosomal protein uL3 9986
104 6GZ4 3 AB ribosomal protein uL3 9986
105 6GZ5 42 AB ribosomal protein uL3 9986
106 6GQV 7 B 60S ribosomal protein L3 4932
107 6GQ1 7 B 60S ribosomal protein L3 4932
108 6GQB 7 B 60S ribosomal protein L3 4932
109 6D9J 2 B uL3 9986
110 6D90 2 B uL3 9986
111 6FTG 2 B uL3 9986
112 6FTI 2 B uL3 9986
113 6FTJ 2 B uL3 9986
114 6FT6 3 B 60S ribosomal protein L3 4932
115 6FRK 10 B Ribosomal protein uL3 9986
116 5Z3G 6 F 60S ribosomal protein L3 4932
117 6C0F 5 B 60S ribosomal protein L3 4932
118 6EM1 16 B 60S ribosomal protein L3 4932
119 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
120 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
121 6ELZ 28 B 60S ribosomal protein L3 4932
122 6EK0 5 LB 60S ribosomal protein L3 9606
123 6AZ3 2 B ribosomal protein uL3 5661
124 5XY3 5 B Uncharacterized protein 5722
125 5XXB 5 B Ribosomal protein uL3 5811
126 5UMD 5 E 60S ribosomal protein L3 5833
127 5MC6 67 BA 60S ribosomal protein L3 4932
128 5H4P 5 B 60S ribosomal protein L3 4932
129 5M1J 42 B5 60S ribosomal protein L3 4932
130 5LZS 2 B uL3 9986
131 5LZT 2 B uL3 9986
132 5LZU 2 B uL3 9986
133 5LZV 2 B uL3 9986
134 5LZW 2 B uL3 9986
135 5LZX 2 B Ul3 9986
136 5LZY 2 B uL3 9986
137 5LZZ 2 B uL3 9986
138 5T62 6 E 60S ribosomal protein L3 4932
139 5T6R 5 E 60S ribosomal protein L3 4932
140 5T5H 29 f Ribosomal protein L13 5693
141 5T2A 30 d uL3 5661
142 5T2C 4 E 60S ribosomal protein L3 9606
143 5LKS 5 LB 60S ribosomal protein L3 9606
144 5JUO 7 G uL3 (yeast L3) 4932
145 5JUP 7 G uL3 (yeast L3) 4932
146 5JUS 7 G uL3 (yeast L3) 4932
147 5JUT 7 G uL3 (yeast L3) 4932
148 5JUU 7 G uL3 (yeast L3) 4932
149 5JCS 3 B 60S ribosomal protein L3 4932
150 5IT7 5 BB 60S ribosomal protein L3 28985
151 3JCT 2 B 60S ribosomal protein L3 4932
152 3JCS 10 B ribosomal protein L3 5661
153 5GAK 17 F 60S ribosomal protein L3 4932
154 5FL8 2 B 60S ribosomal protein L3 4932
155 5APN 5 B 60S ribosomal protein L3 4932
156 5APO 5 B 60S ribosomal protein L3 4932
157 3JBN 70 AE 60S ribosomal protein uL3 5833
158 3JBO 70 AE 60S ribosomal protein uL3 5833
159 3JBP 70 AE 60S ribosomal protein uL3 5833
160 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
161 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
162 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
163 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
164 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
165 3JAG 2 B uL3 9986
166 3JAH 2 B uL3 9986
167 3JAI 2 B uL3 9986
168 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
169 5AJ0 4 AB 60S ribosomal protein L3 9606
170 3J92 2 B uL3 9986
171 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
172 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
173 4V3P 80 LC Ribosomal protein L3 4565
174 3J7O 5 B Ribosomal protein uL3 9823
175 3J7P 5 B Ribosomal protein uL3 9823
176 3J7Q 5 B Ribosomal protein uL3 9823
177 3J7R 5 B Ribosomal protein uL3 9823
178 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
179 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
180 3J79 5 E 60S ribosomal protein uL3 5833
181 3J77 3 L3 60S ribosomal protein L3 4932
182 3J78 3 L3 60S ribosomal protein L3 4932
183 3J6X 6 L3 60S ribosomal protein L3 4932
184 3J6Y 6 L3 60S ribosomal protein L3 4932
185 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
186 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
187 4V7F 6 C 60S ribosomal protein L3 4932
188 4V7E 71 CB 60S ribosomal protein L3 4565
189 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
190 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
191 4V6W 63 CB 60S ribosomal protein L3 7227
192 4V6X 63 CB 60S ribosomal protein L3 9606
193 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
194 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
195 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
196 4V7H 27 BC 60S ribosomal protein L3 5541
197 4V5Z 54 Bb 60S Ribosomal protein L3 9612
198 4V4B 22 BC 60S ribosomal protein L3 4932