6N8N

Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 116 271
95 % 75 120 324
90 % 75 120 343
70 % 76 78 375
50 % 96 172 339
40 % 114 225 261
30 % 114 223 271
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 104 309
95 % 73 106 393
90 % 73 106 416
70 % 74 79 441
50 % 111 208 282
40 % 113 212 285
30 % 113 211 299
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 110 288
95 % 74 73 355
90 % 74 116 367
70 % 76 41 390
50 % 77 120 429
40 % 78 124 447
30 % 78 124 464
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 116 273
95 % 75 116 351
90 % 75 116 369
70 % 76 118 400
50 % 114 213 274
40 % 114 213 281
30 % 115 213 296
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 71 112 305
95 % 78 119 347
90 % 78 119 368
70 % 79 121 397
50 % 114 196 307
40 % 115 199 311
30 % 115 195 328
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 85 277
95 % 75 115 354
90 % 75 115 373
70 % 76 22 405
50 % 76 121 435
40 % 115 223 265
30 % 187 298 198
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 95 494
95 % 73 109 381
90 % 74 112 394
70 % 112 211 248
50 % 116 217 263
40 % 116 217 274
30 % 116 219 286
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 114 283
95 % 74 114 364
90 % 74 114 386
70 % 75 116 415
50 % 75 116 457
40 % 113 211 287
30 % 113 211 302
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 116 272
95 % 75 116 346
90 % 75 116 366
70 % 76 121 399
50 % 76 118 448
40 % 76 118 472
30 % 76 118 491
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 68 100 323
95 % 68 100 418
90 % 69 102 434
70 % 105 192 275
50 % 109 206 284
40 % 109 207 292
30 % 109 207 306
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 106 304
95 % 74 106 394
90 % 74 106 417
70 % 75 108 442
50 % 115 213 272
40 % 115 213 279
30 % 137 230 259
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 118 265
95 % 77 120 323
90 % 77 121 342
70 % 113 210 249
50 % 117 226 254
40 % 187 299 188
30 % 187 304 199
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 108 300
95 % 69 108 388
90 % 75 115 375
70 % 76 117 402
50 % 113 212 276
40 % 113 213 280
30 % 113 212 295
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 16 256
95 % 74 136 329
90 % 75 121 339
70 % 75 146 381
50 % 114 4 257
40 % 115 227 258
30 % 185 301 195
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 116 269
95 % 75 76 344
90 % 76 118 354
70 % 76 118 394
50 % 112 208 281
40 % 113 219 275
30 % 113 219 288
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 110 289
95 % 72 110 374
90 % 72 110 401
70 % 73 113 420
50 % 112 212 277
40 % 112 213 284
30 % 112 122 298
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 114 284
95 % 74 114 369
90 % 75 96 379
70 % 75 116 417
50 % 111 203 296
40 % 112 204 302
30 % 114 203 307
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 110 291
95 % 75 110 375
90 % 76 112 390
70 % 76 112 423
50 % 112 202 297
40 % 112 200 303
30 % 116 217 287
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 83 435
95 % 53 107 557
90 % 53 83 582
70 % 54 84 595
50 % 54 9 635
40 % 54 84 679
30 % 55 85 675
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 117 267
95 % 75 117 336
90 % 76 119 351
70 % 115 222 240
50 % 120 233 244
40 % 120 233 250
30 % 123 240 252
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 45 23 515
95 % 47 70 649
90 % 47 70 683
70 % 48 29 699
50 % 48 71 730
40 % 68 118 474
30 % 68 129 492
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 88 410
95 % 54 88 516
90 % 55 89 537
70 % 55 89 565
50 % 55 89 596
40 % 55 91 615
30 % 55 4 643
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 121 249
95 % 75 121 322
90 % 76 123 338
70 % 76 123 371
50 % 114 220 261
40 % 114 220 269
30 % 114 43 280
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 110 297
95 % 74 110 382
90 % 75 112 395
70 % 75 112 427
50 % 111 198 306
40 % 113 212 286
30 % 115 113 292
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 108 301
95 % 75 87 371
90 % 76 114 385
70 % 76 113 419
50 % 114 216 264
40 % 116 218 272
30 % 119 223 273
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 95 348
95 % 67 10 446
90 % 68 97 458
70 % 68 87 474
50 % 68 97 518
40 % 68 97 548
30 % 68 97 579
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 77 116 264
95 % 77 116 343
90 % 78 118 353
70 % 78 118 392
50 % 94 164 351
40 % 94 164 365
30 % 94 164 375
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 114 279
95 % 75 114 360
90 % 75 114 380
70 % 76 116 407
50 % 113 212 275
40 % 113 212 282
30 % 113 212 297
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 117 260
95 % 75 117 335
90 % 75 117 359
70 % 76 119 389
50 % 113 215 266
40 % 115 221 266
30 % 115 222 276
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 1 21682
95 % 4 5 18646
90 % 4 5 18274
70 % 4 5 17702
50 % 4 5 15172
40 % 4 2 14070
30 % 4 5 13377
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 115 278
95 % 74 115 361
90 % 74 115 381
70 % 75 117 409
50 % 111 203 287
40 % 113 207 291
30 % 114 213 303
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 68 295
95 % 74 110 384
90 % 74 110 406
70 % 75 112 430
50 % 111 83 308
40 % 113 200 313
30 % 114 205 308
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 120 251
95 % 75 148 326
90 % 75 120 348
70 % 76 122 376
50 % 114 216 273
40 % 115 227 257
30 % 117 230 261
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 111 290
95 % 74 69 362
90 % 74 114 382
70 % 75 117 412
50 % 75 117 454
40 % 112 205 295
30 % 112 215 291
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 81 262
95 % 75 117 339
90 % 75 117 362
70 % 76 122 377
50 % 113 220 259
40 % 113 220 267
30 % 113 220 278
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 110 293
95 % 74 110 379
90 % 74 110 408
70 % 75 112 432
50 % 75 112 465
40 % 76 119 466
30 % 76 119 483
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 112 285
95 % 74 112 370
90 % 74 112 391
70 % 110 33 261
50 % 115 220 260
40 % 115 220 268
30 % 115 220 279
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 16 30 1345
95 % 17 11 1713
90 % 30 2 881
70 % 30 85 871
50 % 30 11 887
40 % 31 27 907
30 % 31 72 944
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 1 30583
95 % 3 4 24487
90 % 3 1 23743
70 % 3 4 21656
50 % 23 74 1035
40 % 23 74 1070
30 % 23 74 1123
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 22 38 1555
95 % 22 38 2001
90 % 22 38 2058
70 % 27 43 1863
50 % 29 47 1615
40 % 29 47 1644
30 % 30 49 1590
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 14171
95 % 6 7 14349
90 % 6 4 11722
70 % 6 8 11191
50 % 6 4 11084
40 % 6 8 10440
30 % 6 8 9543
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 5 8295
95 % 9 11 8885
90 % 9 11 8829
70 % 9 11 8559
50 % 9 7 8020
40 % 12 4 6170
30 % 12 7 5868
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 110 292
95 % 74 109 385
90 % 75 87 397
70 % 111 200 264
50 % 113 214 268
40 % 185 289 196
30 % 185 289 206
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 287
95 % 75 116 348
90 % 76 118 357
70 % 76 118 398
50 % 117 227 250
40 % 117 227 256
30 % 117 224 262

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 64 Ba, Da 60S ribosomal protein L28 4932
2 4U4R 64 N8, n8 60S ribosomal protein L28 4932
3 4U3U 64 N8, n8 60S ribosomal protein L28 4932
4 5TBW 29 AB, DC 60S ribosomal protein L28 4932
5 4U3M 64 N8, n8 60S ribosomal protein L28 4932
6 4U3N 64 N8, n8 60S ribosomal protein L28 4932
7 4U52 64 N8, n8 60S ribosomal protein L28 4932
8 4U4Q 64 N8, n8 60S ribosomal protein L28 4932
9 4U6F 64 N8, n8 60S ribosomal protein L28 4932
10 4U4U 64 N8, n8 60S ribosomal protein L28 4932
11 4U4Z 64 N8, n8 60S ribosomal protein L28 4932
12 4U4Y 64 N8, n8 60S ribosomal protein L28 4932
13 4U4N 64 N8, n8 60S ribosomal protein L28 4932
14 4U55 64 N8, n8 60S ribosomal protein L28 4932
15 5DAT 64 N8, n8 60S ribosomal protein L28 4932
16 5I4L 64 N8, n8 60S ribosomal protein L28 4932
17 4U51 64 N8, n8 60S ribosomal protein L28 4932
18 6HHQ 29 AB, DC 60S ribosomal protein L28 4932
19 5OBM 29 N8, n8 60S ribosomal protein L28 4932
20 4U53 64 N8, n8 60S ribosomal protein L28 4932
21 5ON6 30 AB, DC 60S ribosomal protein L28 4932
22 4U50 64 N8, n8 60S ribosomal protein L28 4932
23 5NDV 29 N8, n8 60S ribosomal protein L28 4932
24 5LYB 64 N8, n8 60S ribosomal protein L28 4932
25 4U56 64 N8, n8 60S ribosomal protein L28 4932
26 5TGA 64 N8, n8 60S ribosomal protein L28 4932
27 5MEI 30 AB, DC 60S ribosomal protein L28 4932
28 5FCJ 64 N8, n8 60S ribosomal protein L28 4932
29 4U4O 64 N8, n8 60S ribosomal protein L28 4932
30 5DGV 64 N8, n8 60S ribosomal protein L28 4932
31 5DGE 64 N8, n8 60S ribosomal protein L28 4932
32 5NDW 52 N8, n8 60S ribosomal protein L28 4932
33 4V8P 32 BK, CK, EK, GK 60S RIBOSOMAL PROTEIN L27A 5911
34 5NDG 64 N8, n8 60S ribosomal protein L28 4932
35 5FCI 64 N8, n8 60S ribosomal protein L28 4932
36 5DC3 64 N8, n8 60S ribosomal protein L28 4932
37 5DGF 64 N8, n8 60S ribosomal protein L28 4932
38 5TGM 64 N8, n8 60S ribosomal protein L28 4932
39 4V7R 54 BY, DY 60S ribosomal protein L28 4932
40 6ZU5 4 LAA uL15 235221
41 6ZMO 29 La 60S ribosomal protein L27a 9606
42 6ZME 29 La 60S ribosomal protein L27a 9606
43 6ZMI 29 La 60S ribosomal protein L27a 9606
44 6ZM7 29 La 60S ribosomal protein L27a 9606
45 6ZJ3 66 La Ribosomal protein uL15 3039
46 6XIQ 33 a 60S ribosomal protein L28 4932
47 6XIR 31 a 60S ribosomal protein L28 4932
48 6XA1 29 La 60S ribosomal protein L27a 9606
49 6Z6J 64 La 60S ribosomal protein L28 4932
50 6Z6K 64 La 60S ribosomal protein L28 4932
51 6Z6L 29 La 60S ribosomal protein L27a 9606
52 6Z6M 29 La 60S ribosomal protein L27a 9606
53 6Z6N 29 La 60S ribosomal protein L27a 9606
54 6WOO 29 a uL15 4932
55 6YLG 32 a 60S ribosomal protein L28 4932
56 6YLH 32 a 60S ribosomal protein L28 4932
57 6YLX 23 a 60S ribosomal protein L28 4932
58 6YLY 2 a 60S ribosomal protein L28 4932
59 7BTB 2 a 60S ribosomal protein L28 4932
60 7BT6 25 a 60S ribosomal protein L28 4932
61 6W6L 28 b 60S ribosomal protein L27a 9606
62 6M62 33 a 60S ribosomal protein L28 4932
63 6Y6X 29 La 60S ribosomal protein L27a 9606
64 6Y57 32 La 60S ribosomal protein L27a 9606
65 6Y2L 32 La 60S ribosomal protein L27a 9606
66 6Y0G 32 La 60S ribosomal protein L27a 9606
67 6LU8 20 L 60S ribosomal protein L27a 9606
68 6LSR 18 L 60S ribosomal protein L27a 9606
69 6LSS 18 L 60S ribosomal protein L27a 9606
70 6LQM 18 L 60S ribosomal protein L27a 9606
71 6TNU 66 AR 60S ribosomal protein L28 4932
72 6TH6 39 BO 50S ribosomal protein L15 311400
73 6UZ7 29 Ba RPL28 28985
74 6TB3 66 AR 60S ribosomal protein L28 4932
75 6T83 62 L, ay 60S ribosomal protein L28 4932
76 6T7T 62 La 60S ribosomal protein L28 4932
77 6T7I 62 La 60S ribosomal protein L28 4932
78 6T59 26 a3 uL15 9986
79 6T4Q 61 La 60S ribosomal protein L28 4932
80 6SWA 25 Y 60S ribosomal protein L27a 10090
81 6SV4 63 AR, XR, zR 60S ribosomal protein L28 4932
82 6SNT 62 ap 60S ribosomal protein L28 4932
83 6SKF 39 BO 50S ribosomal protein L15 311400
84 6SKG 39 BO 50S ribosomal protein L15 311400
85 6SGC 61 a2 Ribosomal_L18e/L15P domain-containing protein 9986
86 6S47 29 Ac 60S ribosomal protein L28 4932
87 6RZZ 13 N 60S ribosomal protein L28 4932
88 6S05 13 N 60S ribosomal protein L28 4932
89 6P5I 64 Aa uL15 9986
90 6P5J 64 Aa uL15 9986
91 6P5K 29 Aa uL15 9986
92 6P5N 29 Aa uL15 9986
93 6RM3 5 LAA uL15 6039
94 6RI5 13 N 60S ribosomal protein L28 MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRY FHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPN VPVIVKARFVSKLAEEKIRAAGGVVELIA 4932
95 6OM7 62 b 60S ribosomal protein L27a 9606
96 6OLZ 31 Aa 60S ribosomal protein L27a 9606
97 6OM0 62 b 60S ribosomal protein L27a 9606
98 6OLE 62 b 60S ribosomal protein L27a 9606
99 6OLF 61 b 60S ribosomal protein L27a 9606
100 6OLG 32 Aa 60S ribosomal protein L27a 9606
101 6OLI 62 b 60S ribosomal protein L27a 9606
102 6OIG 28 a 60S ribosomal protein L28 4932
103 6R84 37 c 60S ribosomal protein L28 4932
104 6R86 35 c 60S ribosomal protein L28 4932
105 6R87 36 c 60S ribosomal protein L28 4932
106 6R7Q 56 a uL15 9986
107 6R6G 60 a uL15 9986
108 6R6P 29 a uL15 9986
109 6R5Q 32 a uL15 9986
110 6QZP 29 La 60S ribosomal protein L27a 9606
111 6QTZ 13 N 60S ribosomal protein L28 4932
112 6QT0 14 N 60S ribosomal protein L28 4932
113 6QIK 13 N 60S ribosomal protein L28 4932
114 6Q8Y 19 AR 60S ribosomal protein L28 4932
115 6N8J 4 a 60S ribosomal protein L28 4932
116 6N8K 4 a 60S ribosomal protein L28 4932
117 6N8L 4 a 60S ribosomal protein L28 4932
118 6N8M 32 n 60S ribosomal protein L28 4932
119 6N8N 35 n 60S ribosomal protein L28 4932
120 6N8O 37 n 60S ribosomal protein L28 4932
121 6I7O 63 AR, XR 60S ribosomal protein L28 4932
122 6IP5 29 2U 60S ribosomal protein L27a 9606
123 6IP6 29 2U 60S ribosomal protein L27a 9606
124 6IP8 29 2U 60S ribosomal protein L27a 9606
125 6MTB 32 a 60S ribosomal protein L27a 9986
126 6MTC 30 a 60S ribosomal protein L27a 9986
127 6MTD 29 a uL15 9986
128 6MTE 29 a uL15 9986
129 6HD7 32 c 60S ribosomal protein L28 4932
130 6HCQ 62 a3 uL15 9986
131 6HCJ 62 a3 uL15 9986
132 6HCM 61 a3 uL15 9986
133 6HCF 61 a3 uL15 9986
134 6GZ3 66 Aa ribosomal protein uL15 9986
135 6GZ4 66 Aa ribosomal protein uL15 9986
136 6GZ5 66 Aa ribosomal protein uL15 9986
137 6GQV 31 a 60S ribosomal protein L28 4932
138 6GQ1 31 a 60S ribosomal protein L28 4932
139 6GQB 31 a 60S ribosomal protein L28 4932
140 6D9J 26 a uL15 9986
141 6D90 26 a uL15 9986
142 6FTG 26 a uL15 9986
143 6FTI 26 a uL15 9986
144 6FTJ 26 a uL15 9986
145 6FT6 27 a 60S ribosomal protein L28 4932
146 6FRK 34 a Ribosomal protein uL15 9986
147 6ELZ 22 a 60S ribosomal protein L28 4932
148 6EK0 29 La 60S ribosomal protein L27a 9606
149 6AZ3 12 L ribosomal protein uL15 5661
150 5XY3 29 a Uncharacterized protein 5722
151 5XXB 29 Z Ribosomal protein uL15 5811
152 5UMD 15 O 60S ribosomal protein L27a, putative 5833
153 5MC6 58 AR 60S ribosomal protein L28 4932
154 5H4P 28 a 60S ribosomal protein L28 4932
155 5M1J 39 a5 60S ribosomal protein L28 4932
156 5LZS 26 a uL15 9986
157 5LZT 26 a uL15 9986
158 5LZU 26 a uL15 9986
159 5LZV 26 a uL15 9986
160 5LZW 26 a uL15 9986
161 5LZX 26 a uL15 9986
162 5LZY 26 a uL15 9986
163 5LZZ 26 a uL15 9986
164 5T62 30 n 60S ribosomal protein L28 4932
165 5T6R 29 n 60S ribosomal protein L28 4932
166 5T5H 25 b 60S ribosomal protein L27A/L29 5693
167 5T2A 26 Z uL15 5661
168 5T2C 16 U 60S ribosomal protein L27a 9606
169 5LKS 29 La 60S ribosomal protein L27a 9606
170 5JUO 32 FA uL15 (yeast L28) 4932
171 5JUP 32 FA uL15 (yeast L28) 4932
172 5JUS 32 FA uL15 (yeast L28) 4932
173 5JUT 32 FA uL15 (yeast L28) 4932
174 5JUU 32 FA uL15 (yeast L28) 4932
175 5JCS 48 a 60S ribosomal protein L28 4932
176 5IT7 29 aa RPL28 28985
177 3JCT 27 a 60S ribosomal protein L28 4932
178 3JCS 20 L ribosomal protein L15 5661
179 5GAK 12 c 60S ribosomal protein L28 4932
180 5FL8 26 a 60S ribosomal protein L28 4932
181 5APN 29 a 60S ribosomal protein L28 4932
182 5APO 29 a 60S ribosomal protein L28 4932
183 3JBN 60 AO 60S ribosomal protein uL15 5833
184 3JBO 39 AO 60S ribosomal protein uL15 5833
185 3JBP 60 AO 60S ribosomal protein uL15 5833
186 3JAN 19 a Ribosomal protein uL15 SEE REMARK 999 9986
187 3JAJ 19 a Ribosomal protein uL15 SEE REMARK 999 9986
188 3JAG 26 a uL15 9986
189 3JAH 26 a uL15 9986
190 3JAI 26 a uL15 9986
191 4UG0 29 La 60S RIBOSOMAL PROTEIN L27A 9606
192 5AJ0 29 Aa 60S ribosomal protein L27a 9606
193 3J92 26 a uL15 9986
194 4D67 26 a 60S RIBOSOMAL PROTEIN L27A 9986
195 4D5Y 26 a 60S RIBOSOMAL PROTEIN UL15 9986
196 4V3P 43 LO 60S ribosomal protein L27a-3 4565
197 3J7O 29 a Ribosomal protein uL15 9823
198 3J7P 30 a Ribosomal protein uL15 9823
199 3J7Q 29 a Ribosomal protein uL15 9823
200 3J7R 29 a Ribosomal protein uL15 9823
201 4UJC 32 Ba 60S RIBOSOMAL PROTEIN L27A 9986
202 4UJD 29 Aa 60S RIBOSOMAL PROTEIN L27A 9986
203 3J79 15 O 60S ribosomal protein uL15 5833
204 3J77 28 78 60S ribosomal protein L28 4932
205 3J78 28 78 60S ribosomal protein L28 4932
206 3J6X 30 68 60S ribosomal protein L28 4932
207 3J6Y 30 68 60S ribosomal protein L28 4932
208 4UJE 63 Ca 60S RIBOSOMAL PROTEIN L27A 9986
209 4V91 29 a UL15 RIBOSOMAL PROTEIN UL15 28985
210 4V7F 17 N 60S ribosomal protein L28 4932
211 4V7E 46 Ca 60S ribosomal protein L15 4565
212 4V8Y 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
213 4V8Z 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
214 4V4N 59 AL 50S ribosomal protein L15P SEE REMARK 999 2190
215 4V6W 45 Ca 60S ribosomal protein L27a 7227
216 4V6X 45 Ca 60S ribosomal protein L27a 9606
217 4V8M 61 Bb 60S RIBOSOMAL PROTEIN L27A 185431
218 4V6U 35 BL 50S ribosomal protein L15P 2261
219 4V8T 27 a 60S RIBOSOMAL PROTEIN L28 4932
220 4V6I 44 BO 60S ribosomal protein rpL28 (L15p) 4932
221 4V7H 46 BV 60S ribosomal protein L28 5541
222 4V5Z 64 Bl 60S Ribosomal protein L27a 9612
223 4V4B 41 BV 60S ribosomal protein L28 4932