
Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit

Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 254
95 % 54 99 319
90 % 54 99 333
70 % 54 100 372
50 % 71 147 339
40 % 72 183 260
30 % 72 183 275
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 85 302
95 % 54 87 391
90 % 54 87 408
70 % 54 88 443
50 % 71 168 288
40 % 72 170 295
30 % 72 170 319
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 253
95 % 54 95 342
90 % 54 96 350
70 % 54 97 383
50 % 55 98 441
40 % 56 102 453
30 % 56 102 473
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 260
95 % 54 95 346
90 % 54 95 359
70 % 54 97 386
50 % 71 171 278
40 % 71 171 294
30 % 71 170 322
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 91 303
95 % 57 98 341
90 % 57 98 356
70 % 57 99 387
50 % 74 156 331
40 % 74 158 338
30 % 74 158 354
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 94 261
95 % 54 94 348
90 % 54 94 360
70 % 54 95 397
50 % 71 178 264
40 % 72 179 272
30 % 140 251 200
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 31 67 489
95 % 54 90 368
90 % 54 91 380
70 % 72 171 254
50 % 74 175 263
40 % 74 175 281
30 % 74 175 302
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 268
95 % 53 93 358
90 % 53 93 373
70 % 53 94 405
50 % 53 94 457
40 % 70 168 307
30 % 70 168 328
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 259
95 % 54 95 340
90 % 54 95 357
70 % 54 96 393
50 % 54 96 452
40 % 54 96 480
30 % 54 96 513
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 295
95 % 54 86 395
90 % 54 87 405
70 % 70 157 277
50 % 72 169 286
40 % 71 169 300
30 % 72 170 320
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 296
95 % 54 86 394
90 % 54 86 411
70 % 54 87 445
50 % 71 169 283
40 % 72 170 296
30 % 94 193 250
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 252
95 % 55 99 326
90 % 55 99 337
70 % 71 168 261
50 % 73 182 249
40 % 73 182 265
30 % 73 182 283
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 87 292
95 % 48 87 388
90 % 54 94 365
70 % 54 95 396
50 % 71 170 280
40 % 71 171 290
30 % 71 171 315
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 98 240
95 % 53 98 328
90 % 53 99 334
70 % 53 99 376
50 % 71 180 251
40 % 71 180 271
30 % 71 180 289
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 256
95 % 54 95 344
90 % 54 96 354
70 % 54 96 392
50 % 70 171 290
40 % 70 176 288
30 % 70 176 312
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 51 89 280
95 % 51 89 376
90 % 51 89 395
70 % 51 91 419
50 % 69 169 289
40 % 69 170 301
30 % 69 170 324
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 271
95 % 53 93 363
90 % 53 94 370
70 % 53 94 410
50 % 69 161 321
40 % 70 162 326
30 % 70 163 338
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 279
95 % 54 89 373
90 % 54 90 383
70 % 54 90 427
50 % 70 160 320
40 % 70 166 318
30 % 72 173 309
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 38 68 419
95 % 38 68 566
90 % 38 68 597
70 % 38 68 648
50 % 38 68 685
40 % 38 68 713
30 % 39 69 719
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 251
95 % 54 96 335
90 % 54 97 344
70 % 72 182 236
50 % 72 183 240
40 % 72 183 261
30 % 72 183 276
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 63 427
95 % 40 63 578
90 % 40 63 608
70 % 40 63 658
50 % 40 63 695
40 % 44 105 483
30 % 44 105 514
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 39 73 398
95 % 39 73 523
90 % 39 73 553
70 % 39 73 591
50 % 39 73 625
40 % 39 75 652
30 % 39 76 677
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 100 234
95 % 54 100 317
90 % 54 101 327
70 % 54 101 370
50 % 71 177 259
40 % 71 177 279
30 % 71 177 300
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 289
95 % 53 89 381
90 % 53 90 390
70 % 53 90 433
50 % 69 156 333
40 % 70 169 302
30 % 70 170 323
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 87 297
95 % 54 90 367
90 % 54 91 378
70 % 54 91 415
50 % 71 173 274
40 % 72 174 286
30 % 72 176 301
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 81 314
95 % 53 81 417
90 % 53 82 436
70 % 53 82 472
50 % 53 82 504
40 % 53 82 537
30 % 53 82 562
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 95 245
95 % 56 95 338
90 % 56 96 346
70 % 56 96 385
50 % 69 136 357
40 % 69 136 375
30 % 69 136 387
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 93 264
95 % 54 93 351
90 % 54 93 366
70 % 54 94 398
50 % 71 170 282
40 % 71 170 298
30 % 71 170 321
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 247
95 % 54 96 334
90 % 54 96 349
70 % 54 97 381
50 % 72 174 265
40 % 72 178 274
30 % 72 179 293
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 5 19191
95 % 4 5 17862
90 % 4 5 17512
70 % 4 5 16335
50 % 4 5 14713
40 % 4 5 13695
30 % 4 5 12459
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 94 267
95 % 53 94 356
90 % 53 94 371
70 % 53 95 404
50 % 69 166 306
40 % 70 168 315
30 % 70 168 332
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 286
95 % 53 89 380
90 % 53 89 399
70 % 53 90 430
50 % 69 155 334
40 % 69 155 348
30 % 69 155 362
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 99 235
95 % 54 99 320
90 % 54 99 330
70 % 54 100 371
50 % 70 172 285
40 % 71 183 259
30 % 72 185 266
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 90 283
95 % 53 94 355
90 % 53 94 369
70 % 53 95 403
50 % 53 95 456
40 % 70 163 321
30 % 70 173 313
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 246
95 % 54 96 332
90 % 54 96 347
70 % 58 132 309
50 % 71 178 256
40 % 71 178 275
30 % 71 178 296
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 290
95 % 53 89 383
90 % 53 89 402
70 % 53 90 437
50 % 53 90 474
40 % 54 97 473
30 % 54 97 499
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 92 272
95 % 54 92 362
90 % 54 92 377
70 % 70 161 266
50 % 71 174 268
40 % 71 176 280
30 % 72 177 298
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 31 1558
95 % 9 31 2044
90 % 10 54 1113
70 % 10 57 1063
50 % 10 57 1109
40 % 10 57 1139
30 % 10 57 1180
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 4 25145
95 % 3 4 22136
90 % 3 4 21472
70 % 3 4 19724
50 % 13 64 1062
40 % 13 64 1096
30 % 13 64 1133
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 15 31 1719
95 % 15 31 2257
90 % 15 31 2320
70 % 16 32 2325
50 % 18 36 1830
40 % 18 36 1872
30 % 19 38 1745
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 12708
95 % 6 7 12783
90 % 6 8 10775
70 % 6 8 10671
50 % 6 8 9562
40 % 6 8 9124
30 % 6 8 8454
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 11 7112
95 % 9 11 7738
90 % 9 11 7701
70 % 9 11 7538
50 % 9 11 7110
40 % 9 11 6880
30 % 9 11 6454
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 281
95 % 54 89 377
90 % 54 90 384
70 % 70 159 273
50 % 71 172 275
40 % 139 243 199
30 % 139 243 208
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 93 274
95 % 54 95 343
90 % 54 96 353
70 % 54 96 391
50 % 73 183 239
40 % 73 183 255
30 % 73 185 265


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 45 BG, DG 60S ribosomal protein L8-A 4932
2 4U4R 45 L8, l8 60S ribosomal protein L8-A 4932
3 5TBW 10 CJ, p 60S ribosomal protein L8-A 4932
4 4U3N 45 L8, l8 60S ribosomal protein L8-A 4932
5 4U52 45 L8, l8 60S ribosomal protein L8-A 4932
6 4U4Q 45 L8, l8 60S ribosomal protein L8-A 4932
7 4U6F 45 L8, l8 60S ribosomal protein L8-A 4932
8 4U4U 45 L8, l8 60S ribosomal protein L8-A 4932
9 4U4Z 45 L8, l8 60S ribosomal protein L8-A 4932
10 4U4Y 45 L8, l8 60S ribosomal protein L8-A 4932
11 4U4N 45 L8, l8 60S ribosomal protein L8-A 4932
12 4U55 45 L8, l8 60S ribosomal protein L8-A 4932
13 5DAT 45 L8, l8 60S ribosomal protein L8-A 4932
14 5I4L 45 L8 60S ribosomal protein L8-A 4932
15 5I4L 81 l8 60S ribosomal protein L8-A 4932
16 4U51 45 L8, l8 60S ribosomal protein L8-A 4932
17 6HHQ 10 CJ, p 60S ribosomal protein L8-A 4932
18 5OBM 10 L8, l8 60S ribosomal protein L8-A 4932
19 4U53 45 L8, l8 60S ribosomal protein L8-A 4932
20 5ON6 10 CJ, p 60S ribosomal protein L8-A 4932
21 4U50 45 L8, l8 60S ribosomal protein L8-A 4932
22 5NDV 10 L8, l8 60S ribosomal protein L8-A 4932
23 5LYB 45 L8 60S ribosomal protein L8-A 4932
24 4U56 45 L8, l8 60S ribosomal protein L8-A 4932
25 5TGA 45 L8, l8 60S ribosomal protein L8-A 4932
26 5MEI 10 CJ, p 60S ribosomal protein L8-A 4932
27 5FCJ 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
28 4U4O 45 L8, l8 60S ribosomal protein L8-A 4932
29 5NDW 33 L8, l8 60S ribosomal protein L8-A 4932
30 5NDG 45 L8, l8 60S ribosomal protein L8-A 4932
31 5FCI 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
32 5DC3 45 L8, l8 60S ribosomal protein L8-A 4932
33 5TGM 45 L8 60S ribosomal protein L8-A 4932
34 4V7R 39 BH, DH 60S ribosomal protein L8-A 4932
35 6S47 10 AJ 60S ribosomal protein L8-A 4932
36 6RZZ 8 H 60S ribosomal protein L8-A 4932
37 6S05 8 H 60S ribosomal protein L8-A 4932
38 6RI5 8 H 60S ribosomal protein L8-A 4932
39 6R84 7 K 60S ribosomal protein L8-A 4932
40 6R86 6 K 60S ribosomal protein L8-A 4932
41 6R87 6 K 60S ribosomal protein L8-A 4932
42 6QTZ 8 H 60S ribosomal protein L8-A 4932
43 6QT0 8 H 60S ribosomal protein L8-A 4932
44 6QIK 8 H 60S ribosomal protein L8-A 4932
45 6Q8Y 2 AA 60S ribosomal protein L8-A 4932
46 6N8J 14 G 60S ribosomal protein L8-A 4932
47 6N8K 14 G 60S ribosomal protein L8-A 4932
48 6N8L 14 G 60S ribosomal protein L8-A 4932
49 6N8M 11 J 60S ribosomal protein L8-A 4932
50 6N8N 14 J 60S ribosomal protein L8-A 4932
51 6N8O 15 J 60S ribosomal protein L8-A 4932
52 6I7O 10 AA, XA 60S ribosomal protein L8-A 4932
53 6HD7 14 K 60S ribosomal protein L8-A 4932
54 6GQV 12 G 60S ribosomal protein L8-A 4932
55 6GQ1 12 G 60S ribosomal protein L8-A 4932
56 6GQB 12 G 60S ribosomal protein L8-A 4932
57 6FT6 8 G 60S ribosomal protein L8-A 4932
58 6CB1 9 G 60S ribosomal protein L8-A 4932
59 5Z3G 11 K 60S ribosomal protein L8-A 4932
60 6C0F 10 G 60S ribosomal protein L8-A 4932
61 6EM1 21 G 60S ribosomal protein L8-A 4932
62 6EM3 13 G 60S ribosomal protein L8-A Backbone model 4932
63 6EM4 16 G 60S ribosomal protein L8-A Backbone model 4932
64 6EM5 21 G 60S ribosomal protein L8-A Backbone model 4932
65 6ELZ 53 G 60S ribosomal protein L8-A 4932
66 5MC6 41 AA 60S ribosomal protein L8-A 4932
67 5H4P 10 G 60S ribosomal protein L8-A 4932
68 5M1J 51 G5 60S ribosomal protein L8-A 4932
69 5T62 11 J 60S ribosomal protein L8-A 4932
70 5T6R 10 J 60S ribosomal protein L8-A 4932
71 5JUO 12 L eL8 (yeast L8) 4932
72 5JUP 12 L eL8 (yeast L8) 4932
73 5JUS 12 L eL8 (yeast L8) 4932
74 5JUT 12 L eL8 (yeast L8) 4932
75 5JUU 12 L eL8 (yeast L8) 4932
76 5JCS 13 G 60S ribosomal protein L8-A 4932
77 3JCT 7 G 60S ribosomal protein L8-A 4932
78 5GAK 27 K 60S ribosomal protein L8-A 4932
79 5FL8 7 G 60S ribosomal protein L8-A 4932
80 5APN 10 G 60S ribosomal protein L8-A 4932
81 5APO 10 G 60S ribosomal protein L8-A 4932
82 3J77 8 L8 60S ribosomal protein L8 4932
83 3J78 8 L8 60S ribosomal protein L8 4932
84 3J6X 11 L8 60S ribosomal protein L8 4932
85 3J6Y 11 L8 60S ribosomal protein L8 4932
86 4V91 10 G EL8 RIBOSOMAL PROTEIN EL8 28985
87 4V7F 11 H 60S ribosomal protein L8 4932
91 4V6I 37 BH 60S ribosomal protein rpL8 (L7ae) 4932