
Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit

Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 103 266
95 % 62 107 331
90 % 62 107 350
70 % 63 109 385
50 % 81 157 344
40 % 87 198 263
30 % 87 198 279
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 93 317
95 % 62 95 401
90 % 62 95 420
70 % 63 97 439
50 % 86 183 290
40 % 87 185 293
30 % 87 185 315
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 97 293
95 % 61 102 358
90 % 61 103 370
70 % 63 106 393
50 % 64 107 447
40 % 65 111 459
30 % 65 111 477
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 103 270
95 % 62 103 350
90 % 62 103 371
70 % 63 105 398
50 % 86 185 281
40 % 86 185 298
30 % 86 184 323
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 58 99 321
95 % 65 106 356
90 % 65 106 375
70 % 66 108 401
50 % 87 169 327
40 % 87 171 335
30 % 87 171 354
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 102 271
95 % 62 102 359
90 % 62 102 377
70 % 63 104 405
50 % 86 193 272
40 % 87 195 274
30 % 155 266 205
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 39 75 490
95 % 62 98 387
90 % 63 100 394
70 % 87 186 259
50 % 89 190 271
40 % 89 190 284
30 % 89 190 300
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 101 282
95 % 61 101 373
90 % 61 101 393
70 % 62 103 414
50 % 62 103 465
40 % 85 183 305
30 % 85 183 328
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 103 269
95 % 62 103 357
90 % 62 103 376
70 % 63 105 404
50 % 63 105 459
40 % 63 105 487
30 % 63 105 505
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 94 308
95 % 62 94 407
90 % 63 96 411
70 % 85 169 282
50 % 87 181 299
40 % 86 181 308
30 % 87 182 329
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 94 310
95 % 62 94 405
90 % 62 94 423
70 % 63 96 443
50 % 86 184 283
40 % 87 185 294
30 % 109 208 258
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 105 262
95 % 64 108 330
90 % 64 108 348
70 % 86 183 266
50 % 88 197 254
40 % 88 197 268
30 % 88 197 283
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 95 307
95 % 56 95 403
90 % 62 102 380
70 % 63 104 407
50 % 63 105 458
40 % 63 106 484
30 % 63 106 502
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 106 257
95 % 61 106 334
90 % 62 108 342
70 % 62 108 389
50 % 86 195 259
40 % 86 195 272
30 % 86 195 288
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 103 268
95 % 62 103 355
90 % 63 105 363
70 % 63 105 403
50 % 85 186 287
40 % 85 191 289
30 % 85 191 311
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 97 297
95 % 59 97 391
90 % 59 97 408
70 % 60 100 421
50 % 85 185 285
40 % 85 186 296
30 % 85 186 320
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 101 283
95 % 61 101 377
90 % 62 103 383
70 % 62 103 416
50 % 84 176 318
40 % 85 177 324
30 % 85 178 337
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 97 294
95 % 62 97 390
90 % 63 99 400
70 % 63 99 428
50 % 85 175 316
40 % 85 181 317
30 % 87 188 309
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 42 72 464
95 % 42 72 606
90 % 42 72 635
70 % 43 73 657
50 % 43 73 685
40 % 43 73 723
30 % 44 74 722
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 104 265
95 % 62 104 348
90 % 63 106 353
70 % 87 197 240
50 % 87 198 252
40 % 87 198 262
30 % 87 198 277
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 41 64 483
95 % 43 66 629
90 % 43 66 660
70 % 44 67 678
50 % 44 67 716
40 % 53 114 491
30 % 53 114 512
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 43 77 434
95 % 43 77 560
90 % 44 78 581
70 % 44 78 601
50 % 44 78 635
40 % 44 80 660
30 % 44 81 671
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 108 250
95 % 62 108 322
90 % 63 110 334
70 % 63 110 382
50 % 87 193 265
40 % 87 193 279
30 % 87 193 293
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 97 304
95 % 61 97 396
90 % 62 99 404
70 % 62 99 436
50 % 84 171 325
40 % 85 184 299
30 % 86 186 316
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 95 309
95 % 62 98 383
90 % 63 100 391
70 % 63 100 420
50 % 86 188 275
40 % 87 189 288
30 % 87 191 299
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 89 330
95 % 61 89 434
90 % 62 91 444
70 % 62 91 472
50 % 62 91 508
40 % 62 91 548
30 % 62 91 576
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 64 103 263
95 % 64 103 346
90 % 65 105 352
70 % 65 105 395
50 % 79 146 361
40 % 79 146 375
30 % 79 146 391
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 101 275
95 % 62 101 369
90 % 62 101 388
70 % 63 103 410
50 % 86 185 282
40 % 86 185 295
30 % 86 185 319
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 104 264
95 % 62 104 347
90 % 62 104 368
70 % 63 106 396
50 % 87 189 274
40 % 87 193 280
30 % 87 194 290
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 5 20761
95 % 4 5 18730
90 % 4 5 18387
70 % 4 5 17076
50 % 4 5 15375
40 % 4 5 14268
30 % 4 5 12984
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 102 274
95 % 61 102 366
90 % 61 102 384
70 % 62 104 411
50 % 84 181 307
40 % 85 183 313
30 % 85 183 334
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 97 300
95 % 61 97 393
90 % 61 97 410
70 % 62 99 430
50 % 84 170 326
40 % 84 170 338
30 % 84 170 358
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 107 253
95 % 62 107 328
90 % 62 107 346
70 % 63 109 384
50 % 86 188 280
40 % 87 199 259
30 % 88 201 270
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 98 299
95 % 61 102 370
90 % 61 102 389
70 % 62 104 413
50 % 62 104 463
40 % 85 178 320
30 % 85 188 312
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 104 261
95 % 62 104 345
90 % 62 104 366
70 % 72 148 309
50 % 86 193 266
40 % 86 193 282
30 % 86 193 295
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 97 305
95 % 61 97 399
90 % 61 97 416
70 % 62 99 438
50 % 62 99 486
40 % 63 106 474
30 % 63 106 495
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 63 101 277
95 % 63 101 368
90 % 63 101 386
70 % 85 177 275
50 % 86 189 273
40 % 86 191 283
30 % 87 192 297
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 13 35 1346
95 % 14 36 1736
90 % 18 62 992
70 % 18 65 967
50 % 18 65 999
40 % 18 65 1030
30 % 18 65 1082
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 4 29338
95 % 3 4 24110
90 % 3 4 19923
70 % 3 4 20922
50 % 15 66 1128
40 % 15 66 1169
30 % 15 66 1215
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 15 31 1880
95 % 15 31 2400
90 % 15 31 2459
70 % 16 32 2421
50 % 18 36 1956
40 % 18 36 2000
30 % 19 38 1896
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 13966
95 % 6 7 13463
90 % 6 8 11535
70 % 6 8 11037
50 % 6 8 10207
40 % 6 8 9698
30 % 6 8 9016
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 11 7670
95 % 9 11 8421
90 % 9 11 8372
70 % 9 11 8189
50 % 9 11 7699
40 % 9 11 7409
30 % 9 11 6981
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 97 295
95 % 62 97 388
90 % 63 99 396
70 % 85 174 280
50 % 86 187 277
40 % 154 258 200
30 % 154 258 212
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 101 289
95 % 62 103 354
90 % 63 105 361
70 % 63 105 400
50 % 88 198 251
40 % 88 198 261
30 % 88 200 271


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 45 BG, DG 60S ribosomal protein L8-A 4932
2 4U4R 45 L8, l8 60S ribosomal protein L8-A 4932
3 4U3U 45 L8, l8 60S ribosomal protein L8-A 4932
4 5TBW 10 CJ, p 60S ribosomal protein L8-A 4932
5 4U3M 45 L8, l8 60S ribosomal protein L8-A 4932
6 4U3N 45 L8, l8 60S ribosomal protein L8-A 4932
7 4U52 45 L8, l8 60S ribosomal protein L8-A 4932
8 4U4Q 45 L8, l8 60S ribosomal protein L8-A 4932
9 4U6F 45 L8, l8 60S ribosomal protein L8-A 4932
10 4U4U 45 L8, l8 60S ribosomal protein L8-A 4932
11 4U4Z 45 L8, l8 60S ribosomal protein L8-A 4932
12 4U4Y 45 L8, l8 60S ribosomal protein L8-A 4932
13 4U4N 45 L8, l8 60S ribosomal protein L8-A 4932
14 4U55 45 L8, l8 60S ribosomal protein L8-A 4932
15 5DAT 45 L8, l8 60S ribosomal protein L8-A 4932
16 5I4L 45 L8 60S ribosomal protein L8-A 4932
17 5I4L 81 l8 60S ribosomal protein L8-A 4932
18 4U51 45 L8, l8 60S ribosomal protein L8-A 4932
19 6HHQ 10 CJ, p 60S ribosomal protein L8-A 4932
20 5OBM 10 L8, l8 60S ribosomal protein L8-A 4932
21 4U53 45 L8, l8 60S ribosomal protein L8-A 4932
22 5ON6 10 CJ, p 60S ribosomal protein L8-A 4932
23 4U50 45 L8, l8 60S ribosomal protein L8-A 4932
24 5NDV 10 L8, l8 60S ribosomal protein L8-A 4932
25 5LYB 45 L8 60S ribosomal protein L8-A 4932
26 5LYB 85 l8 60S ribosomal protein L8-A,60S ribosomal protein L8-A,60S Ribosomal Protein L8 4932
27 4U56 45 L8, l8 60S ribosomal protein L8-A 4932
28 5TGA 45 L8, l8 60S ribosomal protein L8-A 4932
29 5MEI 10 CJ, p 60S ribosomal protein L8-A 4932
30 5FCJ 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
31 4U4O 45 L8, l8 60S ribosomal protein L8-A 4932
32 5DGV 45 L8, l8 60S ribosomal protein L8-A (eL8) 4932
33 5DGE 45 L8, l8 60S ribosomal protein L8-A 4932
34 5NDW 33 L8, l8 60S ribosomal protein L8-A 4932
35 4V8P 27 BF, CF, EF, GF RPL7A 5911
36 5NDG 45 L8, l8 60S ribosomal protein L8-A 4932
37 5FCI 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
38 5DC3 45 L8, l8 60S ribosomal protein L8-A 4932
39 5DGF 45 L8, l8 60S ribosomal protein L8-A 4932
40 5TGM 45 L8 60S ribosomal protein L8-A 4932
41 5TGM 86 l8 60S ribosomal protein L8-A,60S Ribosomal Protein L8 4932
42 4V7R 39 BH, DH 60S ribosomal protein L8-A 4932
43 6Y6X 10 LG 60S ribosomal protein L7a 9606
44 6Y57 13 LG 60S ribosomal protein L7a 9606
45 6Y2L 13 LG 60S ribosomal protein L7a 9606
46 6Y0G 13 LG 60S ribosomal protein L7a 9606
47 6TNU 47 AA 60S ribosomal protein L8-A 4932
48 6UZ7 10 AG KLLA0E00573p 28985
49 6TB3 47 AA 60S ribosomal protein L8-A 4932
50 6T83 43 Gy, Ja 60S ribosomal protein L8-A 4932
51 6T7T 43 LG 60S ribosomal protein L8-A 4932
52 6T7I 43 LG 60S ribosomal protein L8-A 4932
53 6T4Q 42 LG 60S ribosomal protein L8-A 4932
54 6SV4 10 AA, XA, zA 60S ribosomal protein L8-A 4932
55 6SNT 43 n 60S ribosomal protein L8-A 4932
56 6S47 10 AJ 60S ribosomal protein L8-A 4932
57 6RZZ 8 H 60S ribosomal protein L8-A 4932
58 6S05 8 H 60S ribosomal protein L8-A 4932
59 6P5I 45 AG eL8 9986
60 6P5J 45 AG eL8 9986
61 6P5K 10 AG eL8 9986
62 6P5N 10 AG eL8 9986
63 6RI5 8 H 60S ribosomal protein L8-A 4932
64 6OM7 43 I 60S ribosomal protein L7a 9606
65 6OLZ 12 AG 60S ribosomal protein L7a 9606
66 6OM0 43 I 60S ribosomal protein L7a 9606
67 6OLE 43 I 60S ribosomal protein L7a 9606
68 6OLF 43 I 60S ribosomal protein L7a 9606
69 6OLG 12 AG 60S ribosomal protein L7a 9606
70 6OLI 43 I 60S ribosomal protein L7a 9606
71 6R84 7 K 60S ribosomal protein L8-A 4932
72 6R86 6 K 60S ribosomal protein L8-A 4932
73 6R87 6 K 60S ribosomal protein L8-A 4932
74 6R7Q 35 G eL8 9986
75 6R6G 24 G eL8 9986
76 6R6P 10 G eL8 9986
77 6R5Q 13 G eL8 9986
78 6QZP 10 LG 60S ribosomal protein L7a 9606
79 6QTZ 8 H 60S ribosomal protein L8-A 4932
80 6QT0 8 H 60S ribosomal protein L8-A 4932
81 6QIK 8 H 60S ribosomal protein L8-A 4932
82 6Q8Y 2 AA 60S ribosomal protein L8-A 4932
83 6N8J 14 G 60S ribosomal protein L8-A 4932
84 6N8K 14 G 60S ribosomal protein L8-A 4932
85 6N8L 14 G 60S ribosomal protein L8-A 4932
86 6N8M 11 J 60S ribosomal protein L8-A 4932
87 6N8N 14 J 60S ribosomal protein L8-A 4932
88 6N8O 15 J 60S ribosomal protein L8-A 4932
89 6I7O 10 AA, XA 60S ribosomal protein L8-A 4932
90 6IP5 10 2B 60S ribosomal protein L7a 9606
91 6IP6 10 2B 60S ribosomal protein L7a 9606
92 6IP8 10 2B 60S ribosomal protein L7a 9606
93 6HD7 14 K 60S ribosomal protein L8-A 4932
94 6GZ3 47 AG ribosomal protein eL8 9986
95 6GZ4 47 AG ribosomal protein eL8 9986
96 6GZ5 47 AG ribosomal protein eL8 9986
97 6GQV 12 G 60S ribosomal protein L8-A 4932
98 6GQ1 12 G 60S ribosomal protein L8-A 4932
99 6GQB 12 G 60S ribosomal protein L8-A 4932
100 6D9J 7 G eL8 9986
101 6D90 7 G eL8 9986
102 6FTG 7 G eL8 9986
103 6FTI 7 G eL8 9986
104 6FTJ 7 G uL8 9986
105 6FT6 8 G 60S ribosomal protein L8-A 4932
106 6FRK 15 G Ribosomal protein eL8 9986
107 6CB1 9 G 60S ribosomal protein L8-A 4932
108 5Z3G 11 K 60S ribosomal protein L8-A 4932
109 6C0F 10 G 60S ribosomal protein L8-A 4932
110 6EM1 21 G 60S ribosomal protein L8-A 4932
111 6EM3 13 G 60S ribosomal protein L8-A Backbone model 4932
112 6EM4 16 G 60S ribosomal protein L8-A Backbone model 4932
113 6EM5 21 G 60S ribosomal protein L8-A Backbone model 4932
114 6ELZ 53 G 60S ribosomal protein L8-A 4932
115 6EK0 10 LG 60S ribosomal protein L7a 9606
116 5XXB 10 G Ribosomal protein eL8 5811
117 5UMD 10 J 60S ribosomal protein L7-3, putative 5833
118 5MC6 41 AA 60S ribosomal protein L8-A 4932
119 5H4P 10 G 60S ribosomal protein L8-A 4932
120 5M1J 51 G5 60S ribosomal protein L8-A 4932
121 5T62 11 J 60S ribosomal protein L8-A 4932
122 5T6R 10 J 60S ribosomal protein L8-A 4932
123 5T2C 31 n 60S ribosomal protein L7a 9606
124 5LKS 10 LG 60S ribosomal protein L7a 9606
125 5JUO 12 L eL8 (yeast L8) 4932
126 5JUP 12 L eL8 (yeast L8) 4932
127 5JUS 12 L eL8 (yeast L8) 4932
128 5JUT 12 L eL8 (yeast L8) 4932
129 5JUU 12 L eL8 (yeast L8) 4932
130 5JCS 13 G 60S ribosomal protein L8-A 4932
131 5IT7 10 GG KLLA0E00573p 28985
132 3JCT 7 G 60S ribosomal protein L8-A 4932
133 5GAK 27 K 60S ribosomal protein L8-A 4932
134 5FL8 7 G 60S ribosomal protein L8-A 4932
135 5APN 10 G 60S ribosomal protein L8-A 4932
136 5APO 10 G 60S ribosomal protein L8-A 4932
137 3JBN 55 AJ 60S ribosomal protein eL8 5833
138 3JBO 78 AJ 60S ribosomal protein eL8 5833
139 3JBP 55 AJ 60S ribosomal protein eL8 5833
140 3JAN 3 G Ribosomal protein eL8 SEE REMARK 999 9986
141 3JAJ 3 G Ribosomal protein eL8 SEE REMARK 999 9986
142 3JAG 7 G eL8 9986
143 3JAH 7 G eL8 9986
144 3JAI 7 G eL8 9986
146 5AJ0 9 AG 60S ribosomal protein L7a 9606
147 3J92 7 G eL8 9986
148 4D67 7 G 60S RIBOSOMAL PROTEIN L7A 9986
150 3J7O 10 G Ribosomal protein eL8 9823
151 3J7P 10 G Ribosomal protein eL8 9823
152 3J7Q 10 G Ribosomal protein eL8 9823
153 3J7R 10 G Ribosomal protein eL8 9823
156 3J79 10 J 60S ribosomal protein eL8 5833
157 3J77 8 L8 60S ribosomal protein L8 4932
158 3J78 8 L8 60S ribosomal protein L8 4932
159 3J6X 11 L8 60S ribosomal protein L8 4932
160 3J6Y 11 L8 60S ribosomal protein L8 4932
162 4V91 10 G EL8 RIBOSOMAL PROTEIN EL8 28985
163 4V7F 11 H 60S ribosomal protein L8 4932
164 4V7E 37 CG 60S ribosomal protein L8E 4565
165 4V8Y 41 BG 60S RIBOSOMAL PROTEIN L8-A 4932
166 4V8Z 41 BG 60S RIBOSOMAL PROTEIN L8-A 4932
167 4V6W 82 CG 60S ribosomal protein L7a 7227
168 4V6X 82 CG 60S ribosomal protein L7a 9606
169 4V8T 7 G 60S RIBOSOMAL PROTEIN L8-A 4932
170 4V6I 37 BH 60S ribosomal protein rpL8 (L7ae) 4932
171 4V5Z 58 Bf 60S Ribosomal protein L7a 9612