
Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit

Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 271
95 % 54 99 339
90 % 54 99 349
70 % 54 100 382
50 % 71 147 341
40 % 74 185 260
30 % 74 185 282
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 85 314
95 % 54 87 411
90 % 54 87 426
70 % 54 88 454
50 % 73 170 294
40 % 74 172 294
30 % 74 172 320
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 267
95 % 54 95 363
90 % 54 96 370
70 % 54 97 395
50 % 55 98 451
40 % 56 102 461
30 % 56 102 477
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 268
95 % 54 95 357
90 % 54 95 372
70 % 54 97 390
50 % 73 173 281
40 % 73 173 293
30 % 73 172 325
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 91 316
95 % 57 98 362
90 % 57 98 374
70 % 57 99 403
50 % 74 156 333
40 % 74 158 341
30 % 74 158 359
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 94 274
95 % 54 94 365
90 % 54 94 377
70 % 54 95 404
50 % 73 180 268
40 % 74 181 272
30 % 142 253 203
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 31 67 500
95 % 54 90 384
90 % 54 91 395
70 % 74 173 257
50 % 76 177 266
40 % 76 177 284
30 % 76 177 307
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 279
95 % 53 93 378
90 % 53 93 389
70 % 53 94 414
50 % 53 94 466
40 % 72 170 308
30 % 72 170 331
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 269
95 % 54 95 360
90 % 54 95 373
70 % 54 96 397
50 % 54 96 459
40 % 54 96 488
30 % 54 96 521
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 307
95 % 54 86 413
90 % 54 87 425
70 % 72 159 278
50 % 74 171 290
40 % 73 171 302
30 % 74 172 323
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 308
95 % 54 86 415
90 % 54 86 431
70 % 54 87 459
50 % 73 171 285
40 % 74 172 295
30 % 96 195 249
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 257
95 % 55 99 343
90 % 55 99 353
70 % 73 170 263
50 % 75 184 249
40 % 75 184 264
30 % 75 184 287
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 87 305
95 % 48 87 409
90 % 54 94 379
70 % 54 95 405
50 % 73 172 282
40 % 73 173 292
30 % 73 173 318
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 98 251
95 % 53 98 342
90 % 53 99 346
70 % 53 99 384
50 % 73 182 255
40 % 73 182 270
30 % 73 182 293
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 270
95 % 54 95 361
90 % 54 96 368
70 % 54 96 401
50 % 72 173 293
40 % 72 178 287
30 % 72 178 310
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 51 89 289
95 % 51 89 396
90 % 51 89 414
70 % 51 91 429
50 % 71 171 292
40 % 71 172 305
30 % 71 172 330
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 282
95 % 53 93 379
90 % 53 94 387
70 % 53 94 416
50 % 71 163 321
40 % 72 164 326
30 % 72 165 343
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 287
95 % 54 89 391
90 % 54 90 400
70 % 54 90 433
50 % 72 162 320
40 % 72 168 321
30 % 74 175 312
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 38 68 443
95 % 38 68 597
90 % 38 68 622
70 % 38 68 665
50 % 38 68 699
40 % 38 68 725
30 % 39 69 734
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 259
95 % 54 96 351
90 % 54 97 358
70 % 74 184 235
50 % 74 185 248
40 % 74 185 261
30 % 74 185 284
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 63 448
95 % 40 63 605
90 % 40 63 630
70 % 40 63 671
50 % 40 63 704
40 % 46 107 486
30 % 46 107 512
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 39 73 415
95 % 39 73 544
90 % 39 73 566
70 % 39 73 600
50 % 39 73 640
40 % 39 75 661
30 % 39 76 691
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 100 246
95 % 54 100 334
90 % 54 101 340
70 % 54 101 376
50 % 73 182 253
40 % 73 182 268
30 % 73 182 291
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 294
95 % 53 89 399
90 % 53 90 404
70 % 53 90 438
50 % 71 158 328
40 % 72 171 306
30 % 73 173 322
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 87 309
95 % 54 90 385
90 % 54 91 396
70 % 54 91 423
50 % 73 175 274
40 % 74 176 285
30 % 74 178 306
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 81 330
95 % 53 81 439
90 % 53 82 452
70 % 53 82 481
50 % 53 82 515
40 % 53 82 556
30 % 53 82 577
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 95 263
95 % 56 95 352
90 % 56 96 359
70 % 56 96 393
50 % 76 181 254
40 % 76 181 269
30 % 76 181 292
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 93 276
95 % 54 93 372
90 % 54 93 384
70 % 54 94 408
50 % 73 172 283
40 % 73 172 296
30 % 73 172 324
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 258
95 % 54 96 353
90 % 54 96 364
70 % 54 97 394
50 % 74 176 269
40 % 74 180 276
30 % 74 181 295
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 5 19563
95 % 4 5 17668
90 % 4 5 17355
70 % 4 5 16180
50 % 4 5 14589
40 % 4 5 13567
30 % 4 5 12355
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 94 278
95 % 53 94 371
90 % 53 94 386
70 % 53 95 410
50 % 71 168 307
40 % 72 170 318
30 % 72 170 339
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 298
95 % 53 89 400
90 % 53 89 418
70 % 53 90 442
50 % 71 157 332
40 % 71 157 346
30 % 71 157 363
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 99 247
95 % 54 99 336
90 % 54 99 345
70 % 54 100 379
50 % 72 174 289
40 % 73 185 258
30 % 74 187 272
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 90 288
95 % 53 94 369
90 % 53 94 383
70 % 53 95 409
50 % 53 95 464
40 % 72 165 322
30 % 72 175 315
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 262
95 % 54 96 350
90 % 54 96 369
70 % 60 134 315
50 % 73 180 259
40 % 73 180 277
30 % 73 180 299
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 300
95 % 53 89 404
90 % 53 89 419
70 % 53 90 444
50 % 53 90 485
40 % 54 97 484
30 % 54 97 509
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 92 281
95 % 54 92 375
90 % 54 92 392
70 % 72 164 269
50 % 73 176 271
40 % 73 178 282
30 % 74 179 301
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 31 1620
95 % 9 31 2122
90 % 10 54 1135
70 % 10 57 1087
50 % 10 57 1131
40 % 10 57 1166
30 % 10 57 1204
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 4 27782
95 % 3 4 22323
90 % 3 4 22204
70 % 3 4 19938
50 % 15 66 1047
40 % 15 66 1090
30 % 15 66 1126
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 15 31 1725
95 % 15 31 2252
90 % 15 31 2305
70 % 16 32 2270
50 % 18 36 1824
40 % 18 36 1873
30 % 19 38 1761
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 12757
95 % 6 7 12960
90 % 6 8 10897
70 % 6 8 10817
50 % 6 8 9683
40 % 6 8 9454
30 % 6 8 8566
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 11 7157
95 % 9 11 7897
90 % 9 11 7860
70 % 9 11 7666
50 % 9 11 7198
40 % 9 11 6955
30 % 9 11 6528
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 293
95 % 54 89 394
90 % 54 90 401
70 % 72 161 274
50 % 73 174 276
40 % 141 245 198
30 % 141 245 210
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 93 285
95 % 54 95 359
90 % 54 96 366
70 % 54 96 400
50 % 75 185 245
40 % 75 185 257
30 % 75 187 270


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 45 BG, DG 60S ribosomal protein L8-A 4932
2 4U4R 45 L8, l8 60S ribosomal protein L8-A 4932
3 4U3U 45 L8, l8 60S ribosomal protein L8-A 4932
4 5TBW 10 CJ, p 60S ribosomal protein L8-A 4932
5 4U3M 45 L8, l8 60S ribosomal protein L8-A 4932
6 4U3N 45 L8, l8 60S ribosomal protein L8-A 4932
7 4U52 45 L8, l8 60S ribosomal protein L8-A 4932
8 4U4Q 45 L8, l8 60S ribosomal protein L8-A 4932
9 4U6F 45 L8, l8 60S ribosomal protein L8-A 4932
10 4U4U 45 L8, l8 60S ribosomal protein L8-A 4932
11 4U4Z 45 L8, l8 60S ribosomal protein L8-A 4932
12 4U4Y 45 L8, l8 60S ribosomal protein L8-A 4932
13 4U4N 45 L8, l8 60S ribosomal protein L8-A 4932
14 4U55 45 L8, l8 60S ribosomal protein L8-A 4932
15 5DAT 45 L8, l8 60S ribosomal protein L8-A 4932
16 5I4L 45 L8 60S ribosomal protein L8-A 4932
17 5I4L 81 l8 60S ribosomal protein L8-A 4932
18 4U51 45 L8, l8 60S ribosomal protein L8-A 4932
19 6HHQ 10 CJ, p 60S ribosomal protein L8-A 4932
20 5OBM 10 L8, l8 60S ribosomal protein L8-A 4932
21 4U53 45 L8, l8 60S ribosomal protein L8-A 4932
22 5ON6 10 CJ, p 60S ribosomal protein L8-A 4932
23 4U50 45 L8, l8 60S ribosomal protein L8-A 4932
24 5NDV 10 L8, l8 60S ribosomal protein L8-A 4932
25 5LYB 45 L8 60S ribosomal protein L8-A 4932
26 5LYB 85 l8 60S ribosomal protein L8-A,60S ribosomal protein L8-A,60S Ribosomal Protein L8 4932
27 4U56 45 L8, l8 60S ribosomal protein L8-A 4932
28 5TGA 45 L8, l8 60S ribosomal protein L8-A 4932
29 5MEI 10 CJ, p 60S ribosomal protein L8-A 4932
30 5FCJ 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
31 4U4O 45 L8, l8 60S ribosomal protein L8-A 4932
32 5DGV 45 L8, l8 60S ribosomal protein L8-A (eL8) 4932
33 5DGE 45 L8, l8 60S ribosomal protein L8-A 4932
34 5NDW 33 L8, l8 60S ribosomal protein L8-A 4932
35 5NDG 45 L8, l8 60S ribosomal protein L8-A 4932
36 5FCI 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
37 5DC3 45 L8, l8 60S ribosomal protein L8-A 4932
38 5DGF 45 L8, l8 60S ribosomal protein L8-A 4932
39 5TGM 45 L8 60S ribosomal protein L8-A 4932
40 5TGM 86 l8 60S ribosomal protein L8-A,60S Ribosomal Protein L8 4932
41 4V7R 39 BH, DH 60S ribosomal protein L8-A 4932
42 6S47 10 AJ 60S ribosomal protein L8-A 4932
43 6RZZ 8 H 60S ribosomal protein L8-A 4932
44 6S05 8 H 60S ribosomal protein L8-A 4932
45 6RI5 8 H 60S ribosomal protein L8-A 4932
46 6R84 7 K 60S ribosomal protein L8-A 4932
47 6R86 6 K 60S ribosomal protein L8-A 4932
48 6R87 6 K 60S ribosomal protein L8-A 4932
49 6QTZ 8 H 60S ribosomal protein L8-A 4932
50 6QT0 8 H 60S ribosomal protein L8-A 4932
51 6QIK 8 H 60S ribosomal protein L8-A 4932
52 6Q8Y 2 AA 60S ribosomal protein L8-A 4932
53 6N8J 14 G 60S ribosomal protein L8-A 4932
54 6N8K 14 G 60S ribosomal protein L8-A 4932
55 6N8L 14 G 60S ribosomal protein L8-A 4932
56 6N8M 11 J 60S ribosomal protein L8-A 4932
57 6N8N 14 J 60S ribosomal protein L8-A 4932
58 6N8O 15 J 60S ribosomal protein L8-A 4932
59 6I7O 10 AA, XA 60S ribosomal protein L8-A 4932
60 6HD7 14 K 60S ribosomal protein L8-A 4932
61 6GQV 12 G 60S ribosomal protein L8-A 4932
62 6GQ1 12 G 60S ribosomal protein L8-A 4932
63 6GQB 12 G 60S ribosomal protein L8-A 4932
64 6FT6 8 G 60S ribosomal protein L8-A 4932
65 6CB1 9 G 60S ribosomal protein L8-A 4932
66 5Z3G 11 K 60S ribosomal protein L8-A 4932
67 6C0F 10 G 60S ribosomal protein L8-A 4932
68 6EM1 21 G 60S ribosomal protein L8-A 4932
69 6EM3 13 G 60S ribosomal protein L8-A Backbone model 4932
70 6EM4 16 G 60S ribosomal protein L8-A Backbone model 4932
71 6EM5 21 G 60S ribosomal protein L8-A Backbone model 4932
72 6ELZ 53 G 60S ribosomal protein L8-A 4932
73 5MC6 41 AA 60S ribosomal protein L8-A 4932
74 5H4P 10 G 60S ribosomal protein L8-A 4932
75 5M1J 51 G5 60S ribosomal protein L8-A 4932
76 5T62 11 J 60S ribosomal protein L8-A 4932
77 5T6R 10 J 60S ribosomal protein L8-A 4932
78 5JUO 12 L eL8 (yeast L8) 4932
79 5JUP 12 L eL8 (yeast L8) 4932
80 5JUS 12 L eL8 (yeast L8) 4932
81 5JUT 12 L eL8 (yeast L8) 4932
82 5JUU 12 L eL8 (yeast L8) 4932
83 5JCS 13 G 60S ribosomal protein L8-A 4932
84 5IT7 10 GG KLLA0E00573p 28985
85 3JCT 7 G 60S ribosomal protein L8-A 4932
86 5GAK 27 K 60S ribosomal protein L8-A 4932
87 5FL8 7 G 60S ribosomal protein L8-A 4932
88 5APN 10 G 60S ribosomal protein L8-A 4932
89 5APO 10 G 60S ribosomal protein L8-A 4932
90 3J77 8 L8 60S ribosomal protein L8 4932
91 3J78 8 L8 60S ribosomal protein L8 4932
92 3J6X 11 L8 60S ribosomal protein L8 4932
93 3J6Y 11 L8 60S ribosomal protein L8 4932
94 4V91 10 G EL8 RIBOSOMAL PROTEIN EL8 28985
95 4V7F 11 H 60S ribosomal protein L8 4932
99 4V6I 37 BH 60S ribosomal protein rpL8 (L7ae) 4932