
Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit

Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 273
95 % 73 118 326
90 % 73 118 346
70 % 74 120 376
50 % 92 168 344
40 % 111 222 254
30 % 111 222 263
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 102 309
95 % 71 104 395
90 % 71 104 417
70 % 72 106 438
50 % 108 205 283
40 % 109 207 283
30 % 109 207 296
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 108 289
95 % 72 113 348
90 % 72 114 363
70 % 74 117 387
50 % 75 118 433
40 % 76 122 445
30 % 76 122 461
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 271
95 % 73 114 343
90 % 73 114 361
70 % 74 116 392
50 % 110 209 275
40 % 110 209 278
30 % 110 208 295
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 110 305
95 % 76 117 344
90 % 76 117 362
70 % 77 119 394
50 % 111 193 309
40 % 111 195 314
30 % 111 195 326
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 112 280
95 % 73 113 349
90 % 73 113 368
70 % 74 115 401
50 % 110 217 263
40 % 111 218 260
30 % 182 293 197
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 46 82 496
95 % 71 107 384
90 % 72 109 395
70 % 109 208 249
50 % 111 212 268
40 % 111 212 270
30 % 111 212 284
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 112 282
95 % 72 112 361
90 % 72 112 382
70 % 73 114 412
50 % 73 114 462
40 % 109 207 285
30 % 109 207 299
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 272
95 % 73 114 340
90 % 73 114 359
70 % 74 116 397
50 % 74 116 448
40 % 74 116 470
30 % 74 116 488
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 68 100 317
95 % 68 100 412
90 % 69 102 425
70 % 104 191 270
50 % 106 203 288
40 % 105 203 292
30 % 106 204 302
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 104 303
95 % 72 104 397
90 % 72 104 418
70 % 73 106 440
50 % 109 207 279
40 % 110 208 279
30 % 132 231 249
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 116 265
95 % 75 119 322
90 % 75 119 341
70 % 110 207 254
50 % 112 221 254
40 % 112 221 255
30 % 112 221 267
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 106 300
95 % 67 106 387
90 % 73 113 367
70 % 74 115 400
50 % 110 209 271
40 % 110 210 273
30 % 110 210 287
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 117 258
95 % 72 117 327
90 % 73 119 339
70 % 73 119 382
50 % 110 219 256
40 % 110 219 257
30 % 110 219 270
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 268
95 % 73 114 342
90 % 74 116 351
70 % 74 116 391
50 % 109 210 280
40 % 109 215 271
30 % 109 215 286
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 108 290
95 % 70 108 379
90 % 70 108 403
70 % 71 111 419
50 % 109 209 276
40 % 109 210 277
30 % 109 210 292
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 112 283
95 % 72 112 359
90 % 73 114 364
70 % 73 114 410
50 % 108 200 297
40 % 109 201 300
30 % 109 202 309
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 108 291
95 % 73 108 374
90 % 74 110 386
70 % 74 110 422
50 % 109 199 298
40 % 109 205 296
30 % 111 212 283
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 51 81 433
95 % 51 81 551
90 % 51 81 575
70 % 52 82 591
50 % 52 82 636
40 % 52 82 674
30 % 53 83 675
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 115 264
95 % 73 115 334
90 % 74 117 348
70 % 111 221 236
50 % 114 227 247
40 % 114 227 247
30 % 114 227 257
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 45 68 504
95 % 47 70 640
90 % 47 70 670
70 % 48 71 687
50 % 48 71 717
40 % 68 129 464
30 % 68 129 483
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 86 405
95 % 52 86 523
90 % 53 87 538
70 % 53 87 566
50 % 53 87 597
40 % 53 89 627
30 % 53 90 645
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 119 251
95 % 73 119 321
90 % 74 121 332
70 % 74 121 372
50 % 111 217 259
40 % 111 217 263
30 % 111 217 278
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 108 295
95 % 72 108 383
90 % 73 110 394
70 % 73 110 428
50 % 108 195 307
40 % 109 208 282
30 % 110 210 291
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 106 302
95 % 73 109 368
90 % 74 111 379
70 % 74 111 416
50 % 110 212 267
40 % 111 213 268
30 % 114 218 273
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 95 341
95 % 67 95 439
90 % 68 97 446
70 % 68 97 469
50 % 68 97 507
40 % 68 97 533
30 % 68 97 565
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 114 260
95 % 75 114 332
90 % 76 116 347
70 % 76 116 385
50 % 90 157 367
40 % 90 157 378
30 % 90 157 389
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 112 277
95 % 73 112 351
90 % 73 112 371
70 % 74 114 404
50 % 110 209 272
40 % 110 209 276
30 % 110 209 289
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 115 266
95 % 73 115 339
90 % 73 115 357
70 % 74 117 389
50 % 111 213 266
40 % 111 217 264
30 % 111 218 275
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 5 20431
95 % 4 5 19760
90 % 4 5 19354
70 % 4 5 17879
50 % 4 5 16049
40 % 4 5 14901
30 % 4 5 13540
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 113 278
95 % 72 113 357
90 % 72 113 374
70 % 73 115 407
50 % 108 205 291
40 % 109 207 291
30 % 110 208 300
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 108 297
95 % 72 108 380
90 % 72 108 406
70 % 73 110 426
50 % 108 194 311
40 % 108 194 317
30 % 108 194 331
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 118 253
95 % 73 118 323
90 % 73 118 343
70 % 74 120 378
50 % 110 212 274
40 % 111 223 251
30 % 112 225 258
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 109 292
95 % 72 113 354
90 % 72 113 376
70 % 73 115 405
50 % 73 115 460
40 % 109 202 298
30 % 109 202 311
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 115 262
95 % 73 115 331
90 % 73 115 354
70 % 96 172 296
50 % 110 217 258
40 % 110 217 262
30 % 110 217 277
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 108 296
95 % 72 108 386
90 % 72 108 408
70 % 73 110 430
50 % 73 110 471
40 % 74 117 460
30 % 74 117 477
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 112 281
95 % 74 112 352
90 % 74 112 373
70 % 109 201 261
50 % 113 218 257
40 % 113 218 259
30 % 114 219 268
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 16 38 1313
95 % 17 39 1697
90 % 30 74 863
70 % 30 77 855
50 % 30 77 877
40 % 30 77 900
30 % 30 77 938
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 4 30219
95 % 3 4 24334
90 % 3 4 23578
70 % 3 4 21506
50 % 23 74 1021
40 % 23 74 1045
30 % 23 74 1093
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 20 36 1645
95 % 20 36 2055
90 % 20 36 2113
70 % 25 41 1900
50 % 27 45 1626
40 % 27 45 1660
30 % 28 47 1611
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 14035
95 % 6 7 14308
90 % 6 8 12614
70 % 6 8 11955
50 % 6 8 10936
40 % 6 8 10315
30 % 6 8 9541
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 11 7964
95 % 9 11 8696
90 % 9 11 8652
70 % 9 11 8405
50 % 9 11 7878
40 % 12 14 6029
30 % 12 14 5751
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 107 294
95 % 72 107 382
90 % 73 109 393
70 % 108 197 266
50 % 109 210 270
40 % 180 284 192
30 % 180 284 205
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 71 112 285
95 % 73 114 345
90 % 74 116 353
70 % 74 116 395
50 % 112 222 252
40 % 112 222 252
30 % 112 224 261


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 45 BG, DG 60S ribosomal protein L8-A 4932
2 4U4R 45 L8, l8 60S ribosomal protein L8-A 4932
3 4U3U 45 L8, l8 60S ribosomal protein L8-A 4932
4 5TBW 10 CJ, p 60S ribosomal protein L8-A 4932
5 4U3M 45 L8, l8 60S ribosomal protein L8-A 4932
6 4U3N 45 L8, l8 60S ribosomal protein L8-A 4932
7 4U52 45 L8, l8 60S ribosomal protein L8-A 4932
8 4U4Q 45 L8, l8 60S ribosomal protein L8-A 4932
9 4U6F 45 L8, l8 60S ribosomal protein L8-A 4932
10 4U4U 45 L8, l8 60S ribosomal protein L8-A 4932
11 4U4Z 45 L8, l8 60S ribosomal protein L8-A 4932
12 4U4Y 45 L8, l8 60S ribosomal protein L8-A 4932
13 4U4N 45 L8, l8 60S ribosomal protein L8-A 4932
14 4U55 45 L8, l8 60S ribosomal protein L8-A 4932
15 5DAT 45 L8, l8 60S ribosomal protein L8-A 4932
16 5I4L 45 L8 60S ribosomal protein L8-A 4932
17 5I4L 81 l8 60S ribosomal protein L8-A 4932
18 4U51 45 L8, l8 60S ribosomal protein L8-A 4932
19 6HHQ 10 CJ, p 60S ribosomal protein L8-A 4932
20 5OBM 10 L8, l8 60S ribosomal protein L8-A 4932
21 4U53 45 L8, l8 60S ribosomal protein L8-A 4932
22 5ON6 10 CJ, p 60S ribosomal protein L8-A 4932
23 4U50 45 L8, l8 60S ribosomal protein L8-A 4932
24 5NDV 10 L8, l8 60S ribosomal protein L8-A 4932
25 5LYB 45 L8 60S ribosomal protein L8-A 4932
26 5LYB 85 l8 60S ribosomal protein L8-A,60S ribosomal protein L8-A,60S Ribosomal Protein L8 4932
27 4U56 45 L8, l8 60S ribosomal protein L8-A 4932
28 5TGA 45 L8, l8 60S ribosomal protein L8-A 4932
29 5MEI 10 CJ, p 60S ribosomal protein L8-A 4932
30 5FCJ 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
31 4U4O 45 L8, l8 60S ribosomal protein L8-A 4932
32 5DGV 45 L8, l8 60S ribosomal protein L8-A (eL8) 4932
33 5DGE 45 L8, l8 60S ribosomal protein L8-A 4932
34 5NDW 33 L8, l8 60S ribosomal protein L8-A 4932
35 5NDG 45 L8, l8 60S ribosomal protein L8-A 4932
36 5FCI 45 L8, l8 60S ribosomal protein L8-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : APGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYT LDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEAKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIE LVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNK AQAKMDKRAKNSDSA 4932
37 5DC3 45 L8, l8 60S ribosomal protein L8-A 4932
38 5DGF 45 L8, l8 60S ribosomal protein L8-A 4932
39 5TGM 45 L8 60S ribosomal protein L8-A 4932
40 5TGM 86 l8 60S ribosomal protein L8-A,60S Ribosomal Protein L8 4932
41 4V7R 39 BH, DH 60S ribosomal protein L8-A 4932
42 6XIQ 7 G RPL8A isoform 1 4932
43 6XIR 7 G RPL8A isoform 1 4932
44 6Z6J 45 LG 60S ribosomal protein L8-A 4932
45 6Z6K 45 LG 60S ribosomal protein L8-A 4932
46 6WOO 10 G eL8 4932
47 6YLG 12 G 60S ribosomal protein L8-A 4932
48 6YLH 12 G 60S ribosomal protein L8-A 4932
49 6YLX 5 G 60S ribosomal protein L8-A 4932
50 6YLY 12 G 60S ribosomal protein L8-A 4932
51 6M62 13 G 60S ribosomal protein L8-A 4932
52 6TNU 47 AA 60S ribosomal protein L8-A 4932
53 6TB3 47 AA 60S ribosomal protein L8-A 4932
54 6T83 43 Gy, Ja 60S ribosomal protein L8-A 4932
55 6T7T 43 LG 60S ribosomal protein L8-A 4932
56 6T7I 43 LG 60S ribosomal protein L8-A 4932
57 6T4Q 42 LG 60S ribosomal protein L8-A 4932
58 6SV4 10 AA, XA, zA 60S ribosomal protein L8-A 4932
59 6SNT 43 n 60S ribosomal protein L8-A 4932
60 6S47 10 AJ 60S ribosomal protein L8-A 4932
61 6RZZ 8 H 60S ribosomal protein L8-A 4932
62 6S05 8 H 60S ribosomal protein L8-A 4932
63 6RI5 8 H 60S ribosomal protein L8-A 4932
64 6OIG 8 G 60S ribosomal protein L8-A 4932
65 6R84 7 K 60S ribosomal protein L8-A 4932
66 6R86 6 K 60S ribosomal protein L8-A 4932
67 6R87 6 K 60S ribosomal protein L8-A 4932
68 6QTZ 8 H 60S ribosomal protein L8-A 4932
69 6QT0 8 H 60S ribosomal protein L8-A 4932
70 6QIK 8 H 60S ribosomal protein L8-A 4932
71 6Q8Y 2 AA 60S ribosomal protein L8-A 4932
72 6N8J 14 G 60S ribosomal protein L8-A 4932
73 6N8K 14 G 60S ribosomal protein L8-A 4932
74 6N8L 14 G 60S ribosomal protein L8-A 4932
75 6N8M 11 J 60S ribosomal protein L8-A 4932
76 6N8N 14 J 60S ribosomal protein L8-A 4932
77 6N8O 15 J 60S ribosomal protein L8-A 4932
78 6I7O 10 AA, XA 60S ribosomal protein L8-A 4932
79 6HD7 14 K 60S ribosomal protein L8-A 4932
80 6GQV 12 G 60S ribosomal protein L8-A 4932
81 6GQ1 12 G 60S ribosomal protein L8-A 4932
82 6GQB 12 G 60S ribosomal protein L8-A 4932
83 6FT6 8 G 60S ribosomal protein L8-A 4932
84 6CB1 9 G 60S ribosomal protein L8-A 4932
85 5Z3G 11 K 60S ribosomal protein L8-A 4932
86 6C0F 10 G 60S ribosomal protein L8-A 4932
87 6EM1 21 G 60S ribosomal protein L8-A 4932
88 6EM3 13 G 60S ribosomal protein L8-A Backbone model 4932
89 6EM4 16 G 60S ribosomal protein L8-A Backbone model 4932
90 6EM5 21 G 60S ribosomal protein L8-A Backbone model 4932
91 6ELZ 53 G 60S ribosomal protein L8-A 4932
92 5MC6 41 AA 60S ribosomal protein L8-A 4932
93 5H4P 10 G 60S ribosomal protein L8-A 4932
94 5M1J 51 G5 60S ribosomal protein L8-A 4932
95 5T62 11 J 60S ribosomal protein L8-A 4932
96 5T6R 10 J 60S ribosomal protein L8-A 4932
97 5JUO 12 L eL8 (yeast L8) 4932
98 5JUP 12 L eL8 (yeast L8) 4932
99 5JUS 12 L eL8 (yeast L8) 4932
100 5JUT 12 L eL8 (yeast L8) 4932
101 5JUU 12 L eL8 (yeast L8) 4932
102 5JCS 13 G 60S ribosomal protein L8-A 4932
103 3JCT 7 G 60S ribosomal protein L8-A 4932
104 5GAK 27 K 60S ribosomal protein L8-A 4932
105 5FL8 7 G 60S ribosomal protein L8-A 4932
106 5APN 10 G 60S ribosomal protein L8-A 4932
107 5APO 10 G 60S ribosomal protein L8-A 4932
108 3J77 8 L8 60S ribosomal protein L8 4932
109 3J78 8 L8 60S ribosomal protein L8 4932
110 3J6X 11 L8 60S ribosomal protein L8 4932
111 3J6Y 11 L8 60S ribosomal protein L8 4932
112 4V91 10 G EL8 RIBOSOMAL PROTEIN EL8 28985
113 4V7F 11 H 60S ribosomal protein L8 4932
114 4V8Y 41 BG 60S RIBOSOMAL PROTEIN L8-A 4932
115 4V8Z 41 BG 60S RIBOSOMAL PROTEIN L8-A 4932
116 4V8T 7 G 60S RIBOSOMAL PROTEIN L8-A 4932
117 4V6I 37 BH 60S ribosomal protein rpL8 (L7ae) 4932