6N8N

Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 271
95 % 54 99 339
90 % 54 99 349
70 % 54 100 382
50 % 71 147 341
40 % 74 185 260
30 % 74 185 282
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 85 314
95 % 54 87 411
90 % 54 87 426
70 % 54 88 454
50 % 73 170 294
40 % 74 172 294
30 % 74 172 320
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 267
95 % 54 95 363
90 % 54 96 370
70 % 54 97 395
50 % 55 98 451
40 % 56 102 461
30 % 56 102 477
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 268
95 % 54 95 357
90 % 54 95 372
70 % 54 97 390
50 % 73 173 281
40 % 73 173 293
30 % 73 172 325
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 91 316
95 % 57 98 362
90 % 57 98 374
70 % 57 99 403
50 % 74 156 333
40 % 74 158 341
30 % 74 158 359
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 94 274
95 % 54 94 365
90 % 54 94 377
70 % 54 95 404
50 % 73 180 268
40 % 74 181 272
30 % 142 253 203
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 31 67 500
95 % 54 90 384
90 % 54 91 395
70 % 74 173 257
50 % 76 177 266
40 % 76 177 284
30 % 76 177 307
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 279
95 % 53 93 378
90 % 53 93 389
70 % 53 94 414
50 % 53 94 466
40 % 72 170 308
30 % 72 170 331
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 269
95 % 54 95 360
90 % 54 95 373
70 % 54 96 397
50 % 54 96 459
40 % 54 96 488
30 % 54 96 521
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 307
95 % 54 86 413
90 % 54 87 425
70 % 72 159 278
50 % 74 171 290
40 % 73 171 302
30 % 74 172 323
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 308
95 % 54 86 415
90 % 54 86 431
70 % 54 87 459
50 % 73 171 285
40 % 74 172 295
30 % 96 195 249
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 257
95 % 55 99 343
90 % 55 99 353
70 % 73 170 263
50 % 75 184 249
40 % 75 184 264
30 % 75 184 287
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 87 305
95 % 48 87 409
90 % 54 94 379
70 % 54 95 405
50 % 73 172 282
40 % 73 173 292
30 % 73 173 318
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 98 251
95 % 53 98 342
90 % 53 99 346
70 % 53 99 384
50 % 73 182 255
40 % 73 182 270
30 % 73 182 293
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 270
95 % 54 95 361
90 % 54 96 368
70 % 54 96 401
50 % 72 173 293
40 % 72 178 287
30 % 72 178 310
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 51 89 289
95 % 51 89 396
90 % 51 89 414
70 % 51 91 429
50 % 71 171 292
40 % 71 172 305
30 % 71 172 330
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 282
95 % 53 93 379
90 % 53 94 387
70 % 53 94 416
50 % 71 163 321
40 % 72 164 326
30 % 72 165 343
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 287
95 % 54 89 391
90 % 54 90 400
70 % 54 90 433
50 % 72 162 320
40 % 72 168 321
30 % 74 175 312
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 38 68 443
95 % 38 68 597
90 % 38 68 622
70 % 38 68 665
50 % 38 68 699
40 % 38 68 725
30 % 39 69 734
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 259
95 % 54 96 351
90 % 54 97 358
70 % 74 184 235
50 % 74 185 248
40 % 74 185 261
30 % 74 185 284
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 63 448
95 % 40 63 605
90 % 40 63 630
70 % 40 63 671
50 % 40 63 704
40 % 46 107 486
30 % 46 107 512
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 39 73 415
95 % 39 73 544
90 % 39 73 566
70 % 39 73 600
50 % 39 73 640
40 % 39 75 661
30 % 39 76 691
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 100 246
95 % 54 100 334
90 % 54 101 340
70 % 54 101 376
50 % 73 182 253
40 % 73 182 268
30 % 73 182 291
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 294
95 % 53 89 399
90 % 53 90 404
70 % 53 90 438
50 % 71 158 328
40 % 72 171 306
30 % 73 173 322
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 87 309
95 % 54 90 385
90 % 54 91 396
70 % 54 91 423
50 % 73 175 274
40 % 74 176 285
30 % 74 178 306
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 81 330
95 % 53 81 439
90 % 53 82 452
70 % 53 82 481
50 % 53 82 515
40 % 53 82 556
30 % 53 82 577
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 95 263
95 % 56 95 352
90 % 56 96 359
70 % 56 96 393
50 % 76 181 254
40 % 76 181 269
30 % 76 181 292
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 93 276
95 % 54 93 372
90 % 54 93 384
70 % 54 94 408
50 % 73 172 283
40 % 73 172 296
30 % 73 172 324
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 258
95 % 54 96 353
90 % 54 96 364
70 % 54 97 394
50 % 74 176 269
40 % 74 180 276
30 % 74 181 295
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 5 19563
95 % 4 5 17668
90 % 4 5 17355
70 % 4 5 16180
50 % 4 5 14589
40 % 4 5 13567
30 % 4 5 12355
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 94 278
95 % 53 94 371
90 % 53 94 386
70 % 53 95 410
50 % 71 168 307
40 % 72 170 318
30 % 72 170 339
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 298
95 % 53 89 400
90 % 53 89 418
70 % 53 90 442
50 % 71 157 332
40 % 71 157 346
30 % 71 157 363
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 99 247
95 % 54 99 336
90 % 54 99 345
70 % 54 100 379
50 % 72 174 289
40 % 73 185 258
30 % 74 187 272
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 90 288
95 % 53 94 369
90 % 53 94 383
70 % 53 95 409
50 % 53 95 464
40 % 72 165 322
30 % 72 175 315
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 262
95 % 54 96 350
90 % 54 96 369
70 % 60 134 315
50 % 73 180 259
40 % 73 180 277
30 % 73 180 299
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 300
95 % 53 89 404
90 % 53 89 419
70 % 53 90 444
50 % 53 90 485
40 % 54 97 484
30 % 54 97 509
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 92 281
95 % 54 92 375
90 % 54 92 392
70 % 72 164 269
50 % 73 176 271
40 % 73 178 282
30 % 74 179 301
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 31 1620
95 % 9 31 2122
90 % 10 54 1135
70 % 10 57 1087
50 % 10 57 1131
40 % 10 57 1166
30 % 10 57 1204
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 4 27782
95 % 3 4 22323
90 % 3 4 22204
70 % 3 4 19938
50 % 15 66 1047
40 % 15 66 1090
30 % 15 66 1126
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 15 31 1725
95 % 15 31 2252
90 % 15 31 2305
70 % 16 32 2270
50 % 18 36 1824
40 % 18 36 1873
30 % 19 38 1761
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 12757
95 % 6 7 12960
90 % 6 8 10897
70 % 6 8 10817
50 % 6 8 9683
40 % 6 8 9454
30 % 6 8 8566
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 11 7157
95 % 9 11 7897
90 % 9 11 7860
70 % 9 11 7666
50 % 9 11 7198
40 % 9 11 6955
30 % 9 11 6528
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 293
95 % 54 89 394
90 % 54 90 401
70 % 72 161 274
50 % 73 174 276
40 % 141 245 198
30 % 141 245 210
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 93 285
95 % 54 95 359
90 % 54 96 366
70 % 54 96 400
50 % 75 185 245
40 % 75 185 257
30 % 75 187 270

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 64 Ba, Da 60S ribosomal protein L28 4932
2 4U4R 64 N8, n8 60S ribosomal protein L28 4932
3 4U3U 64 N8, n8 60S ribosomal protein L28 4932
4 5TBW 29 AB, DC 60S ribosomal protein L28 4932
5 4U3M 64 N8, n8 60S ribosomal protein L28 4932
6 4U3N 64 N8, n8 60S ribosomal protein L28 4932
7 4U52 64 N8, n8 60S ribosomal protein L28 4932
8 4U4Q 64 N8, n8 60S ribosomal protein L28 4932
9 4U6F 64 N8, n8 60S ribosomal protein L28 4932
10 4U4U 64 N8, n8 60S ribosomal protein L28 4932
11 4U4Z 64 N8, n8 60S ribosomal protein L28 4932
12 4U4Y 64 N8, n8 60S ribosomal protein L28 4932
13 4U4N 64 N8, n8 60S ribosomal protein L28 4932
14 4U55 64 N8, n8 60S ribosomal protein L28 4932
15 5DAT 64 N8, n8 60S ribosomal protein L28 4932
16 5I4L 64 N8, n8 60S ribosomal protein L28 4932
17 4U51 64 N8, n8 60S ribosomal protein L28 4932
18 6HHQ 29 AB, DC 60S ribosomal protein L28 4932
19 5OBM 29 N8, n8 60S ribosomal protein L28 4932
20 4U53 64 N8, n8 60S ribosomal protein L28 4932
21 5ON6 30 AB, DC 60S ribosomal protein L28 4932
22 4U50 64 N8, n8 60S ribosomal protein L28 4932
23 5NDV 29 N8, n8 60S ribosomal protein L28 4932
24 5LYB 64 N8, n8 60S ribosomal protein L28 4932
25 4U56 64 N8, n8 60S ribosomal protein L28 4932
26 5TGA 64 N8, n8 60S ribosomal protein L28 4932
27 5MEI 30 AB, DC 60S ribosomal protein L28 4932
28 5FCJ 64 N8, n8 60S ribosomal protein L28 4932
29 4U4O 64 N8, n8 60S ribosomal protein L28 4932
30 5DGV 64 N8, n8 60S ribosomal protein L28 4932
31 5DGE 64 N8, n8 60S ribosomal protein L28 4932
32 5NDW 52 N8, n8 60S ribosomal protein L28 4932
33 4V8P 32 BK, CK, EK, GK 60S RIBOSOMAL PROTEIN L27A 5911
34 5NDG 64 N8, n8 60S ribosomal protein L28 4932
35 5FCI 64 N8, n8 60S ribosomal protein L28 4932
36 5DC3 64 N8, n8 60S ribosomal protein L28 4932
37 5DGF 64 N8, n8 60S ribosomal protein L28 4932
38 5TGM 64 N8, n8 60S ribosomal protein L28 4932
39 4V7R 54 BY, DY 60S ribosomal protein L28 4932
40 6T59 26 a3 uL15 9986
41 6SGC 61 a2 Ribosomal_L18e/L15P domain-containing protein 9986
42 6S47 29 Ac 60S ribosomal protein L28 4932
43 6RZZ 13 N 60S ribosomal protein L28 4932
44 6S05 13 N 60S ribosomal protein L28 4932
45 6P5I 64 Aa uL15 9986
46 6P5J 64 Aa uL15 9986
47 6P5K 29 Aa uL15 9986
48 6P5N 29 Aa uL15 9986
49 6RM3 5 LAA uL15 6039
50 6RI5 13 N 60S ribosomal protein L28 MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRY FHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPN VPVIVKARFVSKLAEEKIRAAGGVVELIA 4932
51 6OM7 62 b 60S ribosomal protein L27a 9606
52 6OLZ 31 Aa 60S ribosomal protein L27a 9606
53 6OM0 62 b 60S ribosomal protein L27a 9606
54 6OLE 62 b 60S ribosomal protein L27a 9606
55 6OLF 61 b 60S ribosomal protein L27a 9606
56 6OLG 32 Aa 60S ribosomal protein L27a 9606
57 6OLI 62 b 60S ribosomal protein L27a 9606
58 6R84 37 c 60S ribosomal protein L28 4932
59 6R86 35 c 60S ribosomal protein L28 4932
60 6R87 36 c 60S ribosomal protein L28 4932
61 6R7Q 56 a uL15 9986
62 6R6G 60 a uL15 9986
63 6R6P 29 a uL15 9986
64 6R5Q 32 a uL15 9986
65 6QZP 29 La 60S ribosomal protein L27a 9606
66 6QTZ 13 N 60S ribosomal protein L28 4932
67 6QT0 14 N 60S ribosomal protein L28 4932
68 6QIK 13 N 60S ribosomal protein L28 4932
69 6Q8Y 19 AR 60S ribosomal protein L28 4932
70 6N8J 4 a 60S ribosomal protein L28 4932
71 6N8K 4 a 60S ribosomal protein L28 4932
72 6N8L 4 a 60S ribosomal protein L28 4932
73 6N8M 32 n 60S ribosomal protein L28 4932
74 6N8N 35 n 60S ribosomal protein L28 4932
75 6N8O 37 n 60S ribosomal protein L28 4932
76 6I7O 63 AR, XR 60S ribosomal protein L28 4932
77 6IP5 29 2U 60S ribosomal protein L27a 9606
78 6IP6 29 2U 60S ribosomal protein L27a 9606
79 6IP8 29 2U 60S ribosomal protein L27a 9606
80 6MTB 32 a 60S ribosomal protein L27a 9986
81 6MTC 30 a 60S ribosomal protein L27a 9986
82 6MTD 29 a uL15 9986
83 6MTE 29 a uL15 9986
84 6HD7 32 c 60S ribosomal protein L28 4932
85 6HCQ 62 a3 uL15 9986
86 6HCJ 62 a3 uL15 9986
87 6HCM 61 a3 uL15 9986
88 6HCF 61 a3 uL15 9986
89 6GZ3 66 Aa ribosomal protein uL15 9986
90 6GZ4 66 Aa ribosomal protein uL15 9986
91 6GZ5 66 Aa ribosomal protein uL15 9986
92 6GQV 31 a 60S ribosomal protein L28 4932
93 6GQ1 31 a 60S ribosomal protein L28 4932
94 6GQB 31 a 60S ribosomal protein L28 4932
95 6D9J 26 a uL15 9986
96 6D90 26 a uL15 9986
97 6FTG 26 a uL15 9986
98 6FTI 26 a uL15 9986
99 6FTJ 26 a uL15 9986
100 6FT6 27 a 60S ribosomal protein L28 4932
101 6FRK 34 a Ribosomal protein uL15 9986
102 6ELZ 22 a 60S ribosomal protein L28 4932
103 6EK0 29 La 60S ribosomal protein L27a 9606
104 6AZ3 12 L ribosomal protein uL15 5661
105 5XY3 29 a Uncharacterized protein 5722
106 5XXB 29 Z Ribosomal protein uL15 5811
107 5UMD 15 O 60S ribosomal protein L27a, putative 5833
108 5MC6 58 AR 60S ribosomal protein L28 4932
109 5H4P 28 a 60S ribosomal protein L28 4932
110 5M1J 39 a5 60S ribosomal protein L28 4932
111 5LZS 26 a uL15 9986
112 5LZT 26 a uL15 9986
113 5LZU 26 a uL15 9986
114 5LZV 26 a uL15 9986
115 5LZW 26 a uL15 9986
116 5LZX 26 a uL15 9986
117 5LZY 26 a uL15 9986
118 5LZZ 26 a uL15 9986
119 5T62 30 n 60S ribosomal protein L28 4932
120 5T6R 29 n 60S ribosomal protein L28 4932
121 5T5H 25 b 60S ribosomal protein L27A/L29 5693
122 5T2A 26 Z uL15 5661
123 5T2C 16 U 60S ribosomal protein L27a 9606
124 5LKS 29 La 60S ribosomal protein L27a 9606
125 5JUO 32 FA uL15 (yeast L28) 4932
126 5JUP 32 FA uL15 (yeast L28) 4932
127 5JUS 32 FA uL15 (yeast L28) 4932
128 5JUT 32 FA uL15 (yeast L28) 4932
129 5JUU 32 FA uL15 (yeast L28) 4932
130 5JCS 48 a 60S ribosomal protein L28 4932
131 5IT7 29 aa RPL28 28985
132 3JCT 27 a 60S ribosomal protein L28 4932
133 3JCS 20 L ribosomal protein L15 5661
134 5GAK 12 c 60S ribosomal protein L28 4932
135 5FL8 26 a 60S ribosomal protein L28 4932
136 5APN 29 a 60S ribosomal protein L28 4932
137 5APO 29 a 60S ribosomal protein L28 4932
138 3JBN 60 AO 60S ribosomal protein uL15 5833
139 3JBO 39 AO 60S ribosomal protein uL15 5833
140 3JBP 60 AO 60S ribosomal protein uL15 5833
141 3JAN 19 a Ribosomal protein uL15 SEE REMARK 999 9986
142 3JAJ 19 a Ribosomal protein uL15 SEE REMARK 999 9986
143 3JAG 26 a uL15 9986
144 3JAH 26 a uL15 9986
145 3JAI 26 a uL15 9986
146 4UG0 29 La 60S RIBOSOMAL PROTEIN L27A 9606
147 5AJ0 29 Aa 60S ribosomal protein L27a 9606
148 3J92 26 a uL15 9986
149 4D67 26 a 60S RIBOSOMAL PROTEIN L27A 9986
150 4D5Y 26 a 60S RIBOSOMAL PROTEIN UL15 9986
151 4V3P 43 LO 60S ribosomal protein L27a-3 4565
152 3J7O 29 a Ribosomal protein uL15 9823
153 3J7P 30 a Ribosomal protein uL15 9823
154 3J7Q 29 a Ribosomal protein uL15 9823
155 3J7R 29 a Ribosomal protein uL15 9823
156 4UJC 32 Ba 60S RIBOSOMAL PROTEIN L27A 9986
157 4UJD 29 Aa 60S RIBOSOMAL PROTEIN L27A 9986
158 3J79 15 O 60S ribosomal protein uL15 5833
159 3J77 28 78 60S ribosomal protein L28 4932
160 3J78 28 78 60S ribosomal protein L28 4932
161 3J6X 30 68 60S ribosomal protein L28 4932
162 3J6Y 30 68 60S ribosomal protein L28 4932
163 4UJE 63 Ca 60S RIBOSOMAL PROTEIN L27A 9986
164 4V91 29 a UL15 RIBOSOMAL PROTEIN UL15 28985
165 4V7F 17 N 60S ribosomal protein L28 4932
166 4V7E 46 Ca 60S ribosomal protein L15 4565
167 4V8Y 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
168 4V8Z 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
169 4V6W 45 Ca 60S ribosomal protein L27a 7227
170 4V6X 45 Ca 60S ribosomal protein L27a 9606
171 4V8M 61 Bb 60S RIBOSOMAL PROTEIN L27A 185431
172 4V8T 27 a 60S RIBOSOMAL PROTEIN L28 4932
173 4V6I 44 BO 60S ribosomal protein rpL28 (L15p) 4932
174 4V7H 46 BV 60S ribosomal protein L28 5541
175 4V5Z 64 Bl 60S Ribosomal protein L27a 9612
176 4V4B 41 BV 60S ribosomal protein L28 4932