6N8N

Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 263
95 % 54 99 331
90 % 54 99 344
70 % 54 100 379
50 % 71 147 343
40 % 74 185 256
30 % 74 185 275
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 85 311
95 % 54 87 407
90 % 54 87 427
70 % 54 88 455
50 % 73 170 292
40 % 74 172 291
30 % 74 172 312
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 264
95 % 54 95 353
90 % 54 96 363
70 % 54 97 394
50 % 55 98 451
40 % 56 102 457
30 % 56 102 475
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 268
95 % 54 95 354
90 % 54 95 370
70 % 54 97 391
50 % 73 173 280
40 % 73 173 290
30 % 73 172 317
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 91 312
95 % 57 98 357
90 % 57 98 371
70 % 57 99 398
50 % 74 156 335
40 % 74 158 338
30 % 74 158 354
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 94 271
95 % 54 94 363
90 % 54 94 379
70 % 54 95 404
50 % 73 180 264
40 % 141 252 192
30 % 142 253 199
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 31 67 498
95 % 54 90 382
90 % 54 91 395
70 % 74 173 254
50 % 76 177 266
40 % 76 177 281
30 % 76 177 300
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 278
95 % 53 93 371
90 % 53 93 387
70 % 53 94 413
50 % 53 94 471
40 % 72 170 302
30 % 72 170 322
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 267
95 % 54 95 358
90 % 54 95 372
70 % 54 96 401
50 % 54 96 463
40 % 54 96 485
30 % 54 96 517
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 306
95 % 54 86 409
90 % 54 87 424
70 % 72 164 268
50 % 74 171 288
40 % 74 172 293
30 % 74 172 316
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 304
95 % 54 86 408
90 % 54 86 428
70 % 54 87 457
50 % 73 171 286
40 % 74 172 294
30 % 96 195 245
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 261
95 % 55 99 334
90 % 55 99 348
70 % 73 170 261
50 % 75 184 247
40 % 75 184 262
30 % 75 184 281
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 87 303
95 % 48 87 404
90 % 54 94 376
70 % 54 95 403
50 % 73 172 281
40 % 73 173 289
30 % 73 173 311
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 98 250
95 % 53 98 337
90 % 53 99 346
70 % 53 99 386
50 % 73 182 251
40 % 73 182 265
30 % 73 182 284
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 266
95 % 54 95 356
90 % 54 96 362
70 % 54 96 397
50 % 72 173 291
40 % 72 178 283
30 % 72 178 304
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 51 89 291
95 % 51 89 389
90 % 51 89 407
70 % 51 91 429
50 % 71 171 290
40 % 71 172 300
30 % 71 172 321
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 277
95 % 53 93 376
90 % 53 94 384
70 % 53 94 416
50 % 71 163 322
40 % 72 164 322
30 % 72 165 335
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 290
95 % 54 89 391
90 % 54 90 401
70 % 54 90 436
50 % 72 162 321
40 % 72 168 316
30 % 74 175 301
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 38 68 438
95 % 38 68 590
90 % 38 68 623
70 % 38 68 664
50 % 38 68 699
40 % 38 68 720
30 % 39 69 730
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 256
95 % 54 96 346
90 % 54 97 356
70 % 74 184 232
50 % 74 185 245
40 % 74 185 257
30 % 74 185 277
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 63 445
95 % 40 63 599
90 % 40 63 631
70 % 40 63 673
50 % 40 63 705
40 % 46 107 483
30 % 46 107 509
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 39 73 410
95 % 39 73 542
90 % 39 73 567
70 % 39 73 602
50 % 39 73 648
40 % 39 75 657
30 % 39 76 690
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 100 244
95 % 54 100 326
90 % 54 101 336
70 % 54 101 375
50 % 73 179 260
40 % 73 179 276
30 % 73 179 293
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 293
95 % 53 89 396
90 % 53 90 402
70 % 53 90 438
50 % 71 158 332
40 % 72 171 301
30 % 73 173 315
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 87 307
95 % 54 90 381
90 % 54 91 397
70 % 54 91 428
50 % 73 175 271
40 % 74 176 282
30 % 74 178 298
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 81 324
95 % 53 81 433
90 % 53 82 453
70 % 53 82 484
50 % 53 82 521
40 % 53 82 550
30 % 53 82 576
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 95 258
95 % 56 95 344
90 % 56 96 352
70 % 56 96 389
50 % 69 136 363
40 % 69 136 377
30 % 69 136 387
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 93 275
95 % 54 93 369
90 % 54 93 380
70 % 54 94 409
50 % 73 172 282
40 % 73 172 292
30 % 73 172 314
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 262
95 % 54 96 350
90 % 54 96 368
70 % 54 97 395
50 % 74 176 269
40 % 74 180 272
30 % 74 181 289
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 5 19531
95 % 4 5 17687
90 % 4 5 17356
70 % 4 5 16179
50 % 4 5 14596
40 % 4 5 13576
30 % 4 5 12361
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 94 274
95 % 53 94 367
90 % 53 94 382
70 % 53 95 412
50 % 71 168 304
40 % 72 170 310
30 % 72 170 327
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 295
95 % 53 89 399
90 % 53 89 421
70 % 53 90 440
50 % 71 157 334
40 % 71 157 343
30 % 71 157 357
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 99 246
95 % 54 99 330
90 % 54 99 345
70 % 54 100 381
50 % 72 174 284
40 % 73 185 255
30 % 74 187 266
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 90 288
95 % 53 94 368
90 % 53 94 385
70 % 53 95 406
50 % 53 95 468
40 % 72 165 318
30 % 72 165 334
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 257
95 % 54 96 348
90 % 54 96 359
70 % 60 134 311
50 % 73 180 255
40 % 73 180 271
30 % 73 180 291
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 300
95 % 53 89 400
90 % 53 89 417
70 % 53 90 442
50 % 53 90 489
40 % 54 97 479
30 % 54 97 504
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 92 280
95 % 54 92 372
90 % 54 92 388
70 % 72 164 267
50 % 73 176 270
40 % 73 178 279
30 % 74 179 294
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 31 1584
95 % 9 31 2099
90 % 10 54 1128
70 % 10 57 1083
50 % 10 57 1128
40 % 10 57 1156
30 % 10 57 1202
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 4 24492
95 % 3 4 20736
90 % 3 4 24045
70 % 3 4 21955
50 % 15 66 1046
40 % 15 66 1079
30 % 15 66 1126
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 15 31 1748
95 % 15 31 2270
90 % 15 31 2327
70 % 16 32 2307
50 % 18 36 1841
40 % 18 36 1879
30 % 19 38 1766
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 12605
95 % 6 7 12700
90 % 6 8 10779
70 % 6 8 10433
50 % 6 8 9641
40 % 6 8 9148
30 % 6 8 8529
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 11 7354
95 % 9 11 7886
90 % 9 11 7850
70 % 9 11 7676
50 % 9 11 7209
40 % 9 11 6980
30 % 9 11 6553
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 289
95 % 54 89 387
90 % 54 90 399
70 % 72 161 273
50 % 73 174 275
40 % 141 245 197
30 % 141 245 208
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 93 284
95 % 54 95 359
90 % 54 96 367
70 % 54 96 402
50 % 75 185 242
40 % 75 185 254
30 % 75 187 265

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 64 Ba, Da 60S ribosomal protein L28 4932
2 4U4R 64 N8, n8 60S ribosomal protein L28 4932
3 4U3U 64 N8, n8 60S ribosomal protein L28 4932
4 5TBW 29 AB, DC 60S ribosomal protein L28 4932
5 4U3M 64 N8, n8 60S ribosomal protein L28 4932
6 4U3N 64 N8, n8 60S ribosomal protein L28 4932
7 4U52 64 N8, n8 60S ribosomal protein L28 4932
8 4U4Q 64 N8, n8 60S ribosomal protein L28 4932
9 4U6F 64 N8, n8 60S ribosomal protein L28 4932
10 4U4U 64 N8, n8 60S ribosomal protein L28 4932
11 4U4Z 64 N8, n8 60S ribosomal protein L28 4932
12 4U4Y 64 N8, n8 60S ribosomal protein L28 4932
13 4U4N 64 N8, n8 60S ribosomal protein L28 4932
14 4U55 64 N8, n8 60S ribosomal protein L28 4932
15 5DAT 64 N8, n8 60S ribosomal protein L28 4932
16 5I4L 64 N8, n8 60S ribosomal protein L28 4932
17 4U51 64 N8, n8 60S ribosomal protein L28 4932
18 6HHQ 29 AB, DC 60S ribosomal protein L28 4932
19 5OBM 29 N8, n8 60S ribosomal protein L28 4932
20 4U53 64 N8, n8 60S ribosomal protein L28 4932
21 5ON6 30 AB, DC 60S ribosomal protein L28 4932
22 4U50 64 N8, n8 60S ribosomal protein L28 4932
23 5NDV 29 N8, n8 60S ribosomal protein L28 4932
24 5LYB 64 N8, n8 60S ribosomal protein L28 4932
25 4U56 64 N8, n8 60S ribosomal protein L28 4932
26 5TGA 64 N8, n8 60S ribosomal protein L28 4932
27 5MEI 30 AB, DC 60S ribosomal protein L28 4932
28 5FCJ 64 N8, n8 60S ribosomal protein L28 4932
29 4U4O 64 N8, n8 60S ribosomal protein L28 4932
30 5DGV 64 N8, n8 60S ribosomal protein L28 4932
31 5DGE 64 N8, n8 60S ribosomal protein L28 4932
32 5NDW 52 N8, n8 60S ribosomal protein L28 4932
33 4V8P 32 BK, CK, EK, GK 60S RIBOSOMAL PROTEIN L27A 5911
34 5NDG 64 N8, n8 60S ribosomal protein L28 4932
35 5FCI 64 N8, n8 60S ribosomal protein L28 4932
36 5DC3 64 N8, n8 60S ribosomal protein L28 4932
37 5DGF 64 N8, n8 60S ribosomal protein L28 4932
38 5TGM 64 N8, n8 60S ribosomal protein L28 4932
39 4V7R 54 BY, DY 60S ribosomal protein L28 4932
40 6T59 26 a3 uL15 9986
41 6SGC 61 a2 Ribosomal_L18e/L15P domain-containing protein 9986
42 6S47 29 Ac 60S ribosomal protein L28 4932
43 6RZZ 13 N 60S ribosomal protein L28 4932
44 6S05 13 N 60S ribosomal protein L28 4932
45 6P5I 64 Aa uL15 9986
46 6P5J 64 Aa uL15 9986
47 6P5K 29 Aa uL15 9986
48 6P5N 29 Aa uL15 9986
49 6RI5 13 N 60S ribosomal protein L28 MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRY FHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPN VPVIVKARFVSKLAEEKIRAAGGVVELIA 4932
50 6OM7 62 b 60S ribosomal protein L27a 9606
51 6OLZ 31 Aa 60S ribosomal protein L27a 9606
52 6OM0 62 b 60S ribosomal protein L27a 9606
53 6OLE 62 b 60S ribosomal protein L27a 9606
54 6OLF 61 b 60S ribosomal protein L27a 9606
55 6OLG 32 Aa 60S ribosomal protein L27a 9606
56 6OLI 62 b 60S ribosomal protein L27a 9606
57 6R84 37 c 60S ribosomal protein L28 4932
58 6R86 35 c 60S ribosomal protein L28 4932
59 6R87 36 c 60S ribosomal protein L28 4932
60 6R7Q 56 a uL15 9986
61 6R6G 60 a uL15 9986
62 6R6P 29 a uL15 9986
63 6R5Q 32 a uL15 9986
64 6QZP 29 La 60S ribosomal protein L27a 9606
65 6QTZ 13 N 60S ribosomal protein L28 4932
66 6QT0 14 N 60S ribosomal protein L28 4932
67 6QIK 13 N 60S ribosomal protein L28 4932
68 6Q8Y 19 AR 60S ribosomal protein L28 4932
69 6N8J 4 a 60S ribosomal protein L28 4932
70 6N8K 4 a 60S ribosomal protein L28 4932
71 6N8L 4 a 60S ribosomal protein L28 4932
72 6N8M 32 n 60S ribosomal protein L28 4932
73 6N8N 35 n 60S ribosomal protein L28 4932
74 6N8O 37 n 60S ribosomal protein L28 4932
75 6I7O 63 AR, XR 60S ribosomal protein L28 4932
76 6IP5 29 2U 60S ribosomal protein L27a 9606
77 6IP6 29 2U 60S ribosomal protein L27a 9606
78 6IP8 29 2U 60S ribosomal protein L27a 9606
79 6MTB 32 a 60S ribosomal protein L27a 9986
80 6MTC 30 a 60S ribosomal protein L27a 9986
81 6MTD 29 a uL15 9986
82 6MTE 29 a uL15 9986
83 6HD7 32 c 60S ribosomal protein L28 4932
84 6HCQ 62 a3 uL15 9986
85 6HCJ 62 a3 uL15 9986
86 6HCM 61 a3 uL15 9986
87 6HCF 61 a3 uL15 9986
88 6GZ3 66 Aa ribosomal protein uL15 9986
89 6GZ4 66 Aa ribosomal protein uL15 9986
90 6GZ5 66 Aa ribosomal protein uL15 9986
91 6GQV 31 a 60S ribosomal protein L28 4932
92 6GQ1 31 a 60S ribosomal protein L28 4932
93 6GQB 31 a 60S ribosomal protein L28 4932
94 6D9J 26 a uL15 9986
95 6D90 26 a uL15 9986
96 6FTG 26 a uL15 9986
97 6FTI 26 a uL15 9986
98 6FTJ 26 a uL15 9986
99 6FT6 27 a 60S ribosomal protein L28 4932
100 6FRK 34 a Ribosomal protein uL15 9986
101 6ELZ 22 a 60S ribosomal protein L28 4932
102 6EK0 29 La 60S ribosomal protein L27a 9606
103 6AZ3 12 L ribosomal protein uL15 5661
104 5XY3 29 a Uncharacterized protein 5722
105 5XXB 29 Z Ribosomal protein uL15 5811
106 5UMD 15 O 60S ribosomal protein L27a, putative 5833
107 5MC6 58 AR 60S ribosomal protein L28 4932
108 5H4P 28 a 60S ribosomal protein L28 4932
109 5M1J 39 a5 60S ribosomal protein L28 4932
110 5LZS 26 a uL15 9986
111 5LZT 26 a uL15 9986
112 5LZU 26 a uL15 9986
113 5LZV 26 a uL15 9986
114 5LZW 26 a uL15 9986
115 5LZX 26 a uL15 9986
116 5LZY 26 a uL15 9986
117 5LZZ 26 a uL15 9986
118 5T62 30 n 60S ribosomal protein L28 4932
119 5T6R 29 n 60S ribosomal protein L28 4932
120 5T5H 25 b 60S ribosomal protein L27A/L29 5693
121 5T2A 26 Z uL15 5661
122 5T2C 16 U 60S ribosomal protein L27a 9606
123 5LKS 29 La 60S ribosomal protein L27a 9606
124 5JUO 32 FA uL15 (yeast L28) 4932
125 5JUP 32 FA uL15 (yeast L28) 4932
126 5JUS 32 FA uL15 (yeast L28) 4932
127 5JUT 32 FA uL15 (yeast L28) 4932
128 5JUU 32 FA uL15 (yeast L28) 4932
129 5JCS 48 a 60S ribosomal protein L28 4932
130 5IT7 29 aa RPL28 28985
131 3JCT 27 a 60S ribosomal protein L28 4932
132 3JCS 20 L ribosomal protein L15 5661
133 5GAK 12 c 60S ribosomal protein L28 4932
134 5FL8 26 a 60S ribosomal protein L28 4932
135 5APN 29 a 60S ribosomal protein L28 4932
136 5APO 29 a 60S ribosomal protein L28 4932
137 3JBN 60 AO 60S ribosomal protein uL15 5833
138 3JBO 39 AO 60S ribosomal protein uL15 5833
139 3JBP 60 AO 60S ribosomal protein uL15 5833
140 3JAN 19 a Ribosomal protein uL15 SEE REMARK 999 9986
141 3JAJ 19 a Ribosomal protein uL15 SEE REMARK 999 9986
142 3JAG 26 a uL15 9986
143 3JAH 26 a uL15 9986
144 3JAI 26 a uL15 9986
145 4UG0 29 La 60S RIBOSOMAL PROTEIN L27A 9606
146 5AJ0 29 Aa 60S ribosomal protein L27a 9606
147 3J92 26 a uL15 9986
148 4D67 26 a 60S RIBOSOMAL PROTEIN L27A 9986
149 4D5Y 26 a 60S RIBOSOMAL PROTEIN UL15 9986
150 4V3P 43 LO 60S ribosomal protein L27a-3 4565
151 3J7O 29 a Ribosomal protein uL15 9823
152 3J7P 30 a Ribosomal protein uL15 9823
153 3J7Q 29 a Ribosomal protein uL15 9823
154 3J7R 29 a Ribosomal protein uL15 9823
155 4UJC 32 Ba 60S RIBOSOMAL PROTEIN L27A 9986
156 4UJD 29 Aa 60S RIBOSOMAL PROTEIN L27A 9986
157 3J79 15 O 60S ribosomal protein uL15 5833
158 3J77 28 78 60S ribosomal protein L28 4932
159 3J78 28 78 60S ribosomal protein L28 4932
160 3J6X 30 68 60S ribosomal protein L28 4932
161 3J6Y 30 68 60S ribosomal protein L28 4932
162 4UJE 63 Ca 60S RIBOSOMAL PROTEIN L27A 9986
163 4V91 29 a UL15 RIBOSOMAL PROTEIN UL15 28985
164 4V7F 17 N 60S ribosomal protein L28 4932
165 4V7E 46 Ca 60S ribosomal protein L15 4565
166 4V8Y 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
167 4V8Z 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
168 4V6W 45 Ca 60S ribosomal protein L27a 7227
169 4V6X 45 Ca 60S ribosomal protein L27a 9606
170 4V8M 61 Bb 60S RIBOSOMAL PROTEIN L27A 185431
171 4V8T 27 a 60S RIBOSOMAL PROTEIN L28 4932
172 4V6I 44 BO 60S ribosomal protein rpL28 (L15p) 4932
173 4V7H 46 BV 60S ribosomal protein L28 5541
174 4V5Z 64 Bl 60S Ribosomal protein L27a 9612
175 4V4B 41 BV 60S ribosomal protein L28 4932