
Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit

Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 116 271
95 % 75 120 324
90 % 75 120 343
70 % 76 78 375
50 % 96 172 339
40 % 114 225 261
30 % 114 223 271
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 104 309
95 % 73 106 393
90 % 73 106 416
70 % 74 79 441
50 % 111 208 282
40 % 113 212 285
30 % 113 211 299
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 110 288
95 % 74 73 355
90 % 74 116 367
70 % 76 41 390
50 % 77 120 429
40 % 78 124 447
30 % 78 124 464
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 116 273
95 % 75 116 351
90 % 75 116 369
70 % 76 118 400
50 % 114 213 274
40 % 114 213 281
30 % 115 213 296
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 71 112 305
95 % 78 119 347
90 % 78 119 368
70 % 79 121 397
50 % 114 196 307
40 % 115 199 311
30 % 115 195 328
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 85 277
95 % 75 115 354
90 % 75 115 373
70 % 76 22 405
50 % 76 121 435
40 % 115 223 265
30 % 187 298 198
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 95 494
95 % 73 109 381
90 % 74 112 394
70 % 112 211 248
50 % 116 217 263
40 % 116 217 274
30 % 116 219 286
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 114 283
95 % 74 114 364
90 % 74 114 386
70 % 75 116 415
50 % 75 116 457
40 % 113 211 287
30 % 113 211 302
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 116 272
95 % 75 116 346
90 % 75 116 366
70 % 76 121 399
50 % 76 118 448
40 % 76 118 472
30 % 76 118 491
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 68 100 323
95 % 68 100 418
90 % 69 102 434
70 % 105 192 275
50 % 109 206 284
40 % 109 207 292
30 % 109 207 306
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 106 304
95 % 74 106 394
90 % 74 106 417
70 % 75 108 442
50 % 115 213 272
40 % 115 213 279
30 % 137 230 259
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 118 265
95 % 77 120 323
90 % 77 121 342
70 % 113 210 249
50 % 117 226 254
40 % 187 299 188
30 % 187 304 199
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 108 300
95 % 69 108 388
90 % 75 115 375
70 % 76 117 402
50 % 113 212 276
40 % 113 213 280
30 % 113 212 295
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 16 256
95 % 74 136 329
90 % 75 121 339
70 % 75 146 381
50 % 114 4 257
40 % 115 227 258
30 % 185 301 195
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 116 269
95 % 75 76 344
90 % 76 118 354
70 % 76 118 394
50 % 112 208 281
40 % 113 219 275
30 % 113 219 288
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 110 289
95 % 72 110 374
90 % 72 110 401
70 % 73 113 420
50 % 112 212 277
40 % 112 213 284
30 % 112 122 298
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 114 284
95 % 74 114 369
90 % 75 96 379
70 % 75 116 417
50 % 111 203 296
40 % 112 204 302
30 % 114 203 307
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 110 291
95 % 75 110 375
90 % 76 112 390
70 % 76 112 423
50 % 112 202 297
40 % 112 200 303
30 % 116 217 287
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 83 435
95 % 53 107 557
90 % 53 83 582
70 % 54 84 595
50 % 54 9 635
40 % 54 84 679
30 % 55 85 675
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 117 267
95 % 75 117 336
90 % 76 119 351
70 % 115 222 240
50 % 120 233 244
40 % 120 233 250
30 % 123 240 252
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 45 23 515
95 % 47 70 649
90 % 47 70 683
70 % 48 29 699
50 % 48 71 730
40 % 68 118 474
30 % 68 129 492
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 88 410
95 % 54 88 516
90 % 55 89 537
70 % 55 89 565
50 % 55 89 596
40 % 55 91 615
30 % 55 4 643
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 121 249
95 % 75 121 322
90 % 76 123 338
70 % 76 123 371
50 % 114 220 261
40 % 114 220 269
30 % 114 43 280
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 110 297
95 % 74 110 382
90 % 75 112 395
70 % 75 112 427
50 % 111 198 306
40 % 113 212 286
30 % 115 113 292
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 108 301
95 % 75 87 371
90 % 76 114 385
70 % 76 113 419
50 % 114 216 264
40 % 116 218 272
30 % 119 223 273
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 95 348
95 % 67 10 446
90 % 68 97 458
70 % 68 87 474
50 % 68 97 518
40 % 68 97 548
30 % 68 97 579
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 77 116 264
95 % 77 116 343
90 % 78 118 353
70 % 78 118 392
50 % 94 164 351
40 % 94 164 365
30 % 94 164 375
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 114 279
95 % 75 114 360
90 % 75 114 380
70 % 76 116 407
50 % 113 212 275
40 % 113 212 282
30 % 113 212 297
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 117 260
95 % 75 117 335
90 % 75 117 359
70 % 76 119 389
50 % 113 215 266
40 % 115 221 266
30 % 115 222 276
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 1 21682
95 % 4 5 18646
90 % 4 5 18274
70 % 4 5 17702
50 % 4 5 15172
40 % 4 2 14070
30 % 4 5 13377
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 115 278
95 % 74 115 361
90 % 74 115 381
70 % 75 117 409
50 % 111 203 287
40 % 113 207 291
30 % 114 213 303
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 68 295
95 % 74 110 384
90 % 74 110 406
70 % 75 112 430
50 % 111 83 308
40 % 113 200 313
30 % 114 205 308
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 120 251
95 % 75 148 326
90 % 75 120 348
70 % 76 122 376
50 % 114 216 273
40 % 115 227 257
30 % 117 230 261
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 111 290
95 % 74 69 362
90 % 74 114 382
70 % 75 117 412
50 % 75 117 454
40 % 112 205 295
30 % 112 215 291
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 81 262
95 % 75 117 339
90 % 75 117 362
70 % 76 122 377
50 % 113 220 259
40 % 113 220 267
30 % 113 220 278
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 110 293
95 % 74 110 379
90 % 74 110 408
70 % 75 112 432
50 % 75 112 465
40 % 76 119 466
30 % 76 119 483
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 112 285
95 % 74 112 370
90 % 74 112 391
70 % 110 33 261
50 % 115 220 260
40 % 115 220 268
30 % 115 220 279
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 16 30 1345
95 % 17 11 1713
90 % 30 2 881
70 % 30 85 871
50 % 30 11 887
40 % 31 27 907
30 % 31 72 944
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 1 30583
95 % 3 4 24487
90 % 3 1 23743
70 % 3 4 21656
50 % 23 74 1035
40 % 23 74 1070
30 % 23 74 1123
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 22 38 1555
95 % 22 38 2001
90 % 22 38 2058
70 % 27 43 1863
50 % 29 47 1615
40 % 29 47 1644
30 % 30 49 1590
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 14171
95 % 6 7 14349
90 % 6 4 11722
70 % 6 8 11191
50 % 6 4 11084
40 % 6 8 10440
30 % 6 8 9543
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 5 8295
95 % 9 11 8885
90 % 9 11 8829
70 % 9 11 8559
50 % 9 7 8020
40 % 12 4 6170
30 % 12 7 5868
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 110 292
95 % 74 109 385
90 % 75 87 397
70 % 111 200 264
50 % 113 214 268
40 % 185 289 196
30 % 185 289 206
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 287
95 % 75 116 348
90 % 76 118 357
70 % 76 118 398
50 % 117 227 250
40 % 117 227 256
30 % 117 224 262


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
34 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
35 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
36 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
37 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
38 4V7R 7 AF, CF 40S ribosomal protein S11 4932
39 7A1G 10 X 40S ribosomal protein S11-A 4932
40 6ZVI 16 t 40S ribosomal protein S11-A 4932
41 6ZU9 10 X 40S ribosomal protein S11-A 4932
42 6ZQB 55 DL 40S ribosomal protein S11-A 4932
43 6ZQC 55 DL 40S ribosomal protein S11-A 4932
44 6ZQD 51 DL 40S ribosomal protein S11-A 4932
45 6ZQE 47 DL 40S ribosomal protein S11-A 4932
46 6ZQF 33 DL 40S ribosomal protein S11-A 4932
47 6ZQG 25 DL 40S ribosomal protein S11-A 4932
48 6XIQ 27 AB 40S ribosomal protein S11-A 4932
49 6XIR 27 AB 40S ribosomal protein S11-A 4932
50 6ZCE 15 M 40S ribosomal protein S11-A 4932
51 6Z6J 17 SL 40S ribosomal protein S11-A 4932
52 6Z6K 17 SL 40S ribosomal protein S11-A 4932
53 6WOO 59 LL uS17 4932
54 6WDR 11 L 40S ribosomal protein S11-A 4932
55 6Y7C 11 L 40S ribosomal protein S11-A 4932
56 6LQP 11 SM 40S ribosomal protein S11-A 4932
57 6LQQ 11 SM 40S ribosomal protein S11-A 4932
58 6LQR 11 SM 40S ribosomal protein S11-A 4932
59 6LQS 11 SM 40S ribosomal protein S11-A 4932
60 6LQT 11 SM 40S ribosomal protein S11-A 4932
61 6LQU 10 SM 40S ribosomal protein S11-A 4932
62 6LQV 9 SM 40S ribosomal protein S11-A 4932
63 6TNU 15 X 40S ribosomal protein S11-A 4932
64 6UZ7 59 L KLLA0A10483p 28985
65 6TB3 15 X 40S ribosomal protein S11-A 4932
66 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
67 6T7T 16 SL 40S ribosomal protein S11-A 4932
68 6T7I 14 SL 40S ribosomal protein S11-A 4932
69 6T4Q 13 SL 40S ribosomal protein S11-A 4932
70 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
71 6SNT 14 L 40S ribosomal protein S11-A 4932
72 6KE6 11 SM 40S ribosomal protein S11-A 4932
73 6S47 57 BM 40S ribosomal protein S11-A 4932
74 6RBD 12 L 40S ribosomal protein S11-A 4932
75 6RBE 10 L 40S ribosomal protein S11-A 4932
76 6Q8Y 79 X 40S ribosomal protein S11-A 4932
77 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
78 6GSM 15 L KLLA0A10483p 28985
79 6GSN 36 L KLLA0A10483p 28985
80 6GQV 59 AB 40S ribosomal protein S11-A 4932
81 6GQ1 59 AB 40S ribosomal protein S11-A 4932
82 6GQB 59 AB 40S ribosomal protein S11-A 4932
83 6FYX 15 L KLLA0A10483p 28985
84 6FYY 15 L KLLA0A10483p 28985
85 6FAI 22 L 40S ribosomal protein S11-A 4932
86 6EML 20 X 40S ribosomal protein S11-A 4932
87 5WLC 12 LD rpS11_uS17 4932
88 5WYJ 42 SM 40S ribosomal protein S11-A 4932
89 5WYK 39 SM 40S ribosomal protein S11-A 4932
90 5TZS 13 D rpS11_uS17 4932
91 5MC6 25 X 40S ribosomal protein S11-A 4932
92 5M1J 19 L2 40S ribosomal protein S11-A 4932
93 5LL6 10 X 40S ribosomal protein S11-A 4932
94 5JUO 61 IB uS17 (yeast S11) 4932
95 5JUP 61 IB uS17 (yeast S11) 4932
96 5JUS 61 IB uS17 (yeast S11) 4932
97 5JUT 61 IB uS17 (yeast S11) 4932
98 5JUU 61 IB uS17 (yeast S11) 4932
99 5IT7 59 L KLLA0A10483p 28985
100 5IT9 12 L Ribosomal protein uS17 28985
101 3JAP 15 L uS17 28985
102 3JAQ 15 L uS17 28985
103 3JAM 13 L uS17 28985
104 4UER 27 Q US17 4934
105 3J81 13 L uS17 28985
106 3J80 10 L uS17 28985
107 3J77 57 11 40S ribosomal protein S11 4932
108 3J78 57 11 40S ribosomal protein S11 4932
109 3J6X 58 11 40S ribosomal protein S11 4932
110 3J6Y 58 11 40S ribosomal protein S11 4932
111 4V92 14 BL US17 28985
112 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
113 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
114 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932