6N8N

Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 273
95 % 73 118 326
90 % 73 118 346
70 % 74 120 376
50 % 92 168 344
40 % 111 222 254
30 % 111 222 263
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 102 309
95 % 71 104 395
90 % 71 104 417
70 % 72 106 438
50 % 108 205 283
40 % 109 207 283
30 % 109 207 296
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 108 289
95 % 72 113 348
90 % 72 114 363
70 % 74 117 387
50 % 75 118 433
40 % 76 122 445
30 % 76 122 461
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 271
95 % 73 114 343
90 % 73 114 361
70 % 74 116 392
50 % 110 209 275
40 % 110 209 278
30 % 110 208 295
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 69 110 305
95 % 76 117 344
90 % 76 117 362
70 % 77 119 394
50 % 111 193 309
40 % 111 195 314
30 % 111 195 326
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 112 280
95 % 73 113 349
90 % 73 113 368
70 % 74 115 401
50 % 110 217 263
40 % 111 218 260
30 % 182 293 197
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 46 82 496
95 % 71 107 384
90 % 72 109 395
70 % 109 208 249
50 % 111 212 268
40 % 111 212 270
30 % 111 212 284
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 112 282
95 % 72 112 361
90 % 72 112 382
70 % 73 114 412
50 % 73 114 462
40 % 109 207 285
30 % 109 207 299
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 272
95 % 73 114 340
90 % 73 114 359
70 % 74 116 397
50 % 74 116 448
40 % 74 116 470
30 % 74 116 488
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 68 100 317
95 % 68 100 412
90 % 69 102 425
70 % 104 191 270
50 % 106 203 288
40 % 105 203 292
30 % 106 204 302
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 104 303
95 % 72 104 397
90 % 72 104 418
70 % 73 106 440
50 % 109 207 279
40 % 110 208 279
30 % 132 231 249
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 116 265
95 % 75 119 322
90 % 75 119 341
70 % 110 207 254
50 % 112 221 254
40 % 112 221 255
30 % 112 221 267
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 106 300
95 % 67 106 387
90 % 73 113 367
70 % 74 115 400
50 % 110 209 271
40 % 110 210 273
30 % 110 210 287
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 117 258
95 % 72 117 327
90 % 73 119 339
70 % 73 119 382
50 % 110 219 256
40 % 110 219 257
30 % 110 219 270
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 114 268
95 % 73 114 342
90 % 74 116 351
70 % 74 116 391
50 % 109 210 280
40 % 109 215 271
30 % 109 215 286
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 70 108 290
95 % 70 108 379
90 % 70 108 403
70 % 71 111 419
50 % 109 209 276
40 % 109 210 277
30 % 109 210 292
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 112 283
95 % 72 112 359
90 % 73 114 364
70 % 73 114 410
50 % 108 200 297
40 % 109 201 300
30 % 109 202 309
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 108 291
95 % 73 108 374
90 % 74 110 386
70 % 74 110 422
50 % 109 199 298
40 % 109 205 296
30 % 111 212 283
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 51 81 433
95 % 51 81 551
90 % 51 81 575
70 % 52 82 591
50 % 52 82 636
40 % 52 82 674
30 % 53 83 675
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 115 264
95 % 73 115 334
90 % 74 117 348
70 % 111 221 236
50 % 114 227 247
40 % 114 227 247
30 % 114 227 257
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 45 68 504
95 % 47 70 640
90 % 47 70 670
70 % 48 71 687
50 % 48 71 717
40 % 68 129 464
30 % 68 129 483
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 86 405
95 % 52 86 523
90 % 53 87 538
70 % 53 87 566
50 % 53 87 597
40 % 53 89 627
30 % 53 90 645
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 119 251
95 % 73 119 321
90 % 74 121 332
70 % 74 121 372
50 % 111 217 259
40 % 111 217 263
30 % 111 217 278
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 108 295
95 % 72 108 383
90 % 73 110 394
70 % 73 110 428
50 % 108 195 307
40 % 109 208 282
30 % 110 210 291
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 106 302
95 % 73 109 368
90 % 74 111 379
70 % 74 111 416
50 % 110 212 267
40 % 111 213 268
30 % 114 218 273
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 67 95 341
95 % 67 95 439
90 % 68 97 446
70 % 68 97 469
50 % 68 97 507
40 % 68 97 533
30 % 68 97 565
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 75 114 260
95 % 75 114 332
90 % 76 116 347
70 % 76 116 385
50 % 90 157 367
40 % 90 157 378
30 % 90 157 389
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 112 277
95 % 73 112 351
90 % 73 112 371
70 % 74 114 404
50 % 110 209 272
40 % 110 209 276
30 % 110 209 289
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 115 266
95 % 73 115 339
90 % 73 115 357
70 % 74 117 389
50 % 111 213 266
40 % 111 217 264
30 % 111 218 275
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 5 20431
95 % 4 5 19760
90 % 4 5 19354
70 % 4 5 17879
50 % 4 5 16049
40 % 4 5 14901
30 % 4 5 13540
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 113 278
95 % 72 113 357
90 % 72 113 374
70 % 73 115 407
50 % 108 205 291
40 % 109 207 291
30 % 110 208 300
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 108 297
95 % 72 108 380
90 % 72 108 406
70 % 73 110 426
50 % 108 194 311
40 % 108 194 317
30 % 108 194 331
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 118 253
95 % 73 118 323
90 % 73 118 343
70 % 74 120 378
50 % 110 212 274
40 % 111 223 251
30 % 112 225 258
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 109 292
95 % 72 113 354
90 % 72 113 376
70 % 73 115 405
50 % 73 115 460
40 % 109 202 298
30 % 109 202 311
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 73 115 262
95 % 73 115 331
90 % 73 115 354
70 % 96 172 296
50 % 110 217 258
40 % 110 217 262
30 % 110 217 277
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 108 296
95 % 72 108 386
90 % 72 108 408
70 % 73 110 430
50 % 73 110 471
40 % 74 117 460
30 % 74 117 477
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 74 112 281
95 % 74 112 352
90 % 74 112 373
70 % 109 201 261
50 % 113 218 257
40 % 113 218 259
30 % 114 219 268
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 16 38 1313
95 % 17 39 1697
90 % 30 74 863
70 % 30 77 855
50 % 30 77 877
40 % 30 77 900
30 % 30 77 938
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 4 30219
95 % 3 4 24334
90 % 3 4 23578
70 % 3 4 21506
50 % 23 74 1021
40 % 23 74 1045
30 % 23 74 1093
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 20 36 1645
95 % 20 36 2055
90 % 20 36 2113
70 % 25 41 1900
50 % 27 45 1626
40 % 27 45 1660
30 % 28 47 1611
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 14035
95 % 6 7 14308
90 % 6 8 12614
70 % 6 8 11955
50 % 6 8 10936
40 % 6 8 10315
30 % 6 8 9541
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 11 7964
95 % 9 11 8696
90 % 9 11 8652
70 % 9 11 8405
50 % 9 11 7878
40 % 12 14 6029
30 % 12 14 5751
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 72 107 294
95 % 72 107 382
90 % 73 109 393
70 % 108 197 266
50 % 109 210 270
40 % 180 284 192
30 % 180 284 205
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 71 112 285
95 % 73 114 345
90 % 74 116 353
70 % 74 116 395
50 % 112 222 252
40 % 112 222 252
30 % 112 224 261

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 40 BB, DB 60S ribosomal protein L3 4932
2 4U4R 40 L3, l3 60S ribosomal protein L3 4932
3 4U3U 40 L3, l3 60S ribosomal protein L3 4932
4 5TBW 5 CE, k 60S ribosomal protein L3 4932
5 4U3M 40 L3, l3 60S ribosomal protein L3 4932
6 4U3N 40 L3, l3 60S ribosomal protein L3 4932
7 4U52 40 L3, l3 60S ribosomal protein L3 4932
8 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
9 4U6F 40 L3, l3 60S ribosomal protein L3 4932
10 4U4U 40 L3, l3 60S ribosomal protein L3 4932
11 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
12 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
13 4U4N 40 L3, l3 60S ribosomal protein L3 4932
14 4U55 40 L3, l3 60S ribosomal protein L3 4932
15 5DAT 40 L3, l3 60S ribosomal protein L3 4932
16 5I4L 40 L3, l3 60S ribosomal protein L3 4932
17 4U51 40 L3, l3 60S ribosomal protein L3 4932
18 6HHQ 5 CE, k 60S ribosomal protein L3 4932
19 5OBM 5 L3, l3 60S ribosomal protein L3 4932
20 4U53 40 L3, l3 60S ribosomal protein L3 4932
21 5ON6 5 CE, k 60S ribosomal protein L3 4932
22 4U50 40 L3, l3 60S ribosomal protein L3 4932
23 5NDV 5 L3, l3 60S ribosomal protein L3 4932
24 5LYB 40 L3, l3 60S ribosomal protein L3 4932
25 4U56 40 L3, l3 60S ribosomal protein L3 4932
26 5TGA 40 L3, l3 60S ribosomal protein L3 4932
27 5MEI 5 CE, k 60S ribosomal protein L3 4932
28 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
29 4U4O 40 L3, l3 60S ribosomal protein L3 4932
30 5DGV 40 L3, l3 60S ribosomal protein L3 4932
31 5DGE 40 L3, l3 60S ribosomal protein L3 4932
32 5NDW 28 L3, l3 60S ribosomal protein L3 4932
33 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
34 5NDG 40 L3, l3 60S ribosomal protein L3 4932
35 5FCI 40 L3, l3 60S ribosomal protein L3 4932
36 5DC3 40 L3, l3 60S ribosomal protein L3 4932
37 5DGF 40 L3, l3 60S ribosomal protein L3 4932
38 5TGM 40 L3, l3 60S ribosomal protein L3 4932
39 4V7R 34 BC, DC 60S ribosomal protein L3 4932
40 6ZMO 5 LB 60S ribosomal protein L3 9606
41 6ZME 5 LB 60S ribosomal protein L3 9606
42 6ZMI 5 LB 60S ribosomal protein L3 9606
43 6ZM7 5 LB 60S ribosomal protein L3 9606
44 6XIQ 2 B RPL3 isoform 1 4932
45 6XIR 2 B RPL3 isoform 1 4932
46 6Z6J 40 LB 60S ribosomal protein L3 4932
47 6Z6K 40 LB 60S ribosomal protein L3 4932
48 6Z6L 5 LB 60S ribosomal protein L3 9606
49 6Z6M 5 LB 60S ribosomal protein L3 9606
50 6Z6N 5 LB 60S ribosomal protein L3 9606
51 6WOO 5 B uL3 4932
52 6YLG 7 B 60S ribosomal protein L3 4932
53 6YLH 7 B 60S ribosomal protein L3 4932
54 6YLX 1 B 60S ribosomal protein L3 4932
55 6YLY 3 B 60S ribosomal protein L3 4932
56 6W6L 2 B 60S ribosomal protein L3 9606
57 6M62 8 B 60S ribosomal protein L3 4932
58 6Y6X 5 LB 60S ribosomal protein L3 9606
59 6Y57 8 LB 60S ribosomal protein L3 9606
60 6Y2L 8 LB 60S ribosomal protein L3 9606
61 6Y0G 8 LB 60S ribosomal protein L3 9606
62 6LU8 11 B 60S ribosomal protein L3 9606
63 6LSR 9 B 60S ribosomal protein L3 9606
64 6LSS 9 B 60S ribosomal protein L3 9606
65 6LQM 8 B 60S ribosomal protein L3 9606
66 6TNU 42 BA 60S ribosomal protein L3 4932
67 6UZ7 5 AB 60S ribosomal protein L3 28985
68 6TB3 42 BA 60S ribosomal protein L3 4932
69 6T83 38 By, Ea 60S ribosomal protein L3 4932
70 6T7T 3 LB 60S ribosomal protein L3 4932
71 6T7I 38 LB 60S ribosomal protein L3 4932
72 6T59 2 B3 uL3 9986
73 6T4Q 37 LB 60S ribosomal protein L3 4932
74 6SWA 2 B 60S ribosomal protein L3 10090
75 6SV4 5 BA, YA, ZA 60S ribosomal protein L3 4932
76 6SNT 38 i 60S ribosomal protein L3 4932
77 6SGC 37 B2 uL3 9986
78 6S47 5 AE 60S ribosomal protein L3 4932
79 6RZZ 3 C 60S ribosomal protein L3 4932
80 6S05 3 C 60S ribosomal protein L3 4932
81 6P5I 40 AB uL3 9986
82 6P5J 40 AB uL3 9986
83 6P5K 5 AB uL3 9986
84 6P5N 5 AB uL3 9986
85 6RM3 7 LB0 uL3 6039
86 6RI5 3 C 60S ribosomal protein L3 4932
87 6OM7 36 B 60S ribosomal protein L3 9606
88 6OLZ 3 AB 60S ribosomal protein L3 9606
89 6OM0 36 B 60S ribosomal protein L3 9606
90 6OLE 36 B 60S ribosomal protein L3 9606
91 6OLF 36 B 60S ribosomal protein L3 9606
92 6OLG 3 AB 60S ribosomal protein L3 9606
93 6OLI 36 B 60S ribosomal protein L3 9606
94 6OIG 3 B 60S ribosomal protein L3 4932
95 6R84 42 F 60S ribosomal protein L3 4932
96 6R86 40 F 60S ribosomal protein L3 4932
97 6R87 41 F 60S ribosomal protein L3 4932
98 6R7Q 30 B uL3 9986
99 6R6G 13 B uL3 9986
100 6R6P 5 B uL3 9986
101 6R5Q 8 B uL3 9986
102 6QZP 5 LB 60S ribosomal protein L3 9606
103 6QTZ 3 C 60S ribosomal protein L3 4932
104 6QT0 3 C 60S ribosomal protein L3 4932
105 6QKL 2 A 60S ribosomal protein L3 44689
106 6QIK 3 C 60S ribosomal protein L3 4932
107 6Q8Y 38 BA 60S ribosomal protein L3 4932
108 6N8J 5 B 60S ribosomal protein L3 4932
109 6N8K 5 B 60S ribosomal protein L3 4932
110 6N8L 5 B 60S ribosomal protein L3 4932
111 6N8M 6 E 60S ribosomal protein L3 4932
112 6N8N 9 E 60S ribosomal protein L3 4932
113 6N8O 10 E 60S ribosomal protein L3 4932
114 6I7O 5 BA, YA 60S ribosomal protein L3 4932
115 6IP5 5 1E 60S ribosomal protein L3 9606
116 6IP6 5 1E 60S ribosomal protein L3 9606
117 6IP8 5 1E 60S ribosomal protein L3 9606
118 6MTB 8 B 60S ribosomal protein L3 9986
119 6MTC 6 B 60S ribosomal protein L3 9986
120 6MTD 5 B uL3 9986
121 6MTE 5 B uL3 9986
122 6HD7 9 F 60S ribosomal protein L3 4932
123 6HCQ 39 B3 uL3 9986
124 6HCJ 39 B3 uL3 9986
125 6HCM 41 B3 uL3 9986
126 6HCF 41 B3 uL3 9986
127 6GZ3 42 AB ribosomal protein uL3 9986
128 6GZ4 3 AB ribosomal protein uL3 9986
129 6GZ5 42 AB ribosomal protein uL3 9986
130 6GQV 7 B 60S ribosomal protein L3 4932
131 6GQ1 7 B 60S ribosomal protein L3 4932
132 6GQB 7 B 60S ribosomal protein L3 4932
133 6D9J 2 B uL3 9986
134 6D90 2 B uL3 9986
135 6FTG 2 B uL3 9986
136 6FTI 2 B uL3 9986
137 6FTJ 2 B uL3 9986
138 6FT6 3 B 60S ribosomal protein L3 4932
139 6FRK 10 B Ribosomal protein uL3 9986
140 5Z3G 6 F 60S ribosomal protein L3 4932
141 6C0F 5 B 60S ribosomal protein L3 4932
142 6EM1 16 B 60S ribosomal protein L3 4932
143 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
144 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
145 6ELZ 28 B 60S ribosomal protein L3 4932
146 6EK0 5 LB 60S ribosomal protein L3 9606
147 6AZ3 2 B ribosomal protein uL3 5661
148 5XY3 5 B Uncharacterized protein 5722
149 5XXB 5 B Ribosomal protein uL3 5811
150 5UMD 5 E 60S ribosomal protein L3 5833
151 5MC6 67 BA 60S ribosomal protein L3 4932
152 5H4P 5 B 60S ribosomal protein L3 4932
153 5M1J 42 B5 60S ribosomal protein L3 4932
154 5LZS 2 B uL3 9986
155 5LZT 2 B uL3 9986
156 5LZU 2 B uL3 9986
157 5LZV 2 B uL3 9986
158 5LZW 2 B uL3 9986
159 5LZX 2 B Ul3 9986
160 5LZY 2 B uL3 9986
161 5LZZ 2 B uL3 9986
162 5T62 6 E 60S ribosomal protein L3 4932
163 5T6R 5 E 60S ribosomal protein L3 4932
164 5T5H 29 f Ribosomal protein L13 5693
165 5T2A 30 d uL3 5661
166 5T2C 4 E 60S ribosomal protein L3 9606
167 5LKS 5 LB 60S ribosomal protein L3 9606
168 5JUO 7 G uL3 (yeast L3) 4932
169 5JUP 7 G uL3 (yeast L3) 4932
170 5JUS 7 G uL3 (yeast L3) 4932
171 5JUT 7 G uL3 (yeast L3) 4932
172 5JUU 7 G uL3 (yeast L3) 4932
173 5JCS 3 B 60S ribosomal protein L3 4932
174 5IT7 5 BB 60S ribosomal protein L3 28985
175 3JCT 2 B 60S ribosomal protein L3 4932
176 3JCS 10 B ribosomal protein L3 5661
177 5GAK 17 F 60S ribosomal protein L3 4932
178 5FL8 2 B 60S ribosomal protein L3 4932
179 5APN 5 B 60S ribosomal protein L3 4932
180 5APO 5 B 60S ribosomal protein L3 4932
181 3JBN 70 AE 60S ribosomal protein uL3 5833
182 3JBO 70 AE 60S ribosomal protein uL3 5833
183 3JBP 70 AE 60S ribosomal protein uL3 5833
184 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
185 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
186 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
187 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
188 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
189 3JAG 2 B uL3 9986
190 3JAH 2 B uL3 9986
191 3JAI 2 B uL3 9986
192 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
193 5AJ0 4 AB 60S ribosomal protein L3 9606
194 3J92 2 B uL3 9986
195 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
196 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
197 4V3P 80 LC Ribosomal protein L3 4565
198 3J7O 5 B Ribosomal protein uL3 9823
199 3J7P 5 B Ribosomal protein uL3 9823
200 3J7Q 5 B Ribosomal protein uL3 9823
201 3J7R 5 B Ribosomal protein uL3 9823
202 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
203 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
204 3J79 5 E 60S ribosomal protein uL3 5833
205 3J77 3 L3 60S ribosomal protein L3 4932
206 3J78 3 L3 60S ribosomal protein L3 4932
207 3J6X 6 L3 60S ribosomal protein L3 4932
208 3J6Y 6 L3 60S ribosomal protein L3 4932
209 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
210 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
211 4V7F 6 C 60S ribosomal protein L3 4932
212 4V7E 71 CB 60S ribosomal protein L3 4565
213 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
214 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
215 4V4N 45 AC 50S ribosomal protein L3P SEE REMARK 999 2190
216 4V6W 63 CB 60S ribosomal protein L3 7227
217 4V6X 63 CB 60S ribosomal protein L3 9606
218 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
219 4V6U 33 BC 50S ribosomal protein L3P 2261
220 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
221 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
222 4V7H 27 BC 60S ribosomal protein L3 5541
223 4V5Z 54 Bb 60S Ribosomal protein L3 9612
224 4V4B 22 BC 60S ribosomal protein L3 4932