6N8N

Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit


Sequence Similarity Clusters for the Entities in PDB 6N8N

Entity #1 | Chains: A
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: F
60S ribosomal protein L4-A protein, length: 362 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 259
95 % 54 99 325
90 % 54 99 336
70 % 54 100 375
50 % 71 147 337
40 % 72 183 258
30 % 72 183 276
Entity #11 | Chains: G
60S ribosomal protein L5 protein, length: 297 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 85 301
95 % 54 87 395
90 % 54 87 411
70 % 54 88 444
50 % 71 168 288
40 % 72 170 292
30 % 72 170 316
Entity #12 | Chains: H
60S ribosomal protein L6-A protein, length: 176 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 256
95 % 54 95 349
90 % 54 96 357
70 % 54 97 386
50 % 55 98 443
40 % 56 102 452
30 % 56 102 469
Entity #13 | Chains: I
60S ribosomal protein L7-A protein, length: 244 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 255
95 % 54 95 346
90 % 54 95 358
70 % 54 97 383
50 % 71 171 278
40 % 71 171 291
30 % 71 170 320
Entity #14 | Chains: J
60S ribosomal protein L8-A protein, length: 256 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 50 91 304
95 % 57 98 347
90 % 57 98 359
70 % 57 99 392
50 % 74 156 328
40 % 74 158 335
30 % 74 158 350
Entity #15 | Chains: K
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 94 260
95 % 54 94 351
90 % 54 94 363
70 % 54 95 398
50 % 71 178 265
40 % 72 179 271
30 % 140 251 199
Entity #16 | Chains: M
60S ribosomal protein L11-A protein, length: 174 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 31 67 492
95 % 54 90 372
90 % 54 91 381
70 % 72 171 253
50 % 74 175 263
40 % 74 175 280
30 % 74 175 301
Entity #17 | Chains: N
60S ribosomal protein L13-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 269
95 % 53 93 364
90 % 53 93 377
70 % 53 94 410
50 % 69 161 315
40 % 70 168 304
30 % 70 168 325
Entity #18 | Chains: O
60S ribosomal protein L14-A protein, length: 138 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 258
95 % 54 95 350
90 % 54 95 361
70 % 54 96 396
50 % 54 96 453
40 % 54 96 481
30 % 54 96 510
Entity #19 | Chains: Q
60S ribosomal protein L42-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 294
95 % 54 86 397
90 % 54 87 407
70 % 70 162 264
50 % 72 169 284
40 % 72 170 293
30 % 72 170 317
Entity #2 | Chains: B
5S rRNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #20 | Chains: R
60S ribosomal protein L43-A protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 86 295
95 % 54 86 399
90 % 54 86 415
70 % 54 87 447
50 % 71 169 283
40 % 72 170 294
30 % 94 193 249
Entity #21 | Chains: S
Ribosomal Protein uL1 protein, length: 217 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: a
60S ribosomal protein L15-A protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 97 246
95 % 55 99 329
90 % 55 99 340
70 % 71 168 259
50 % 73 182 248
40 % 73 182 262
30 % 73 182 283
Entity #23 | Chains: b
60S ribosomal protein L16-A protein, length: 199 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 48 87 293
95 % 48 87 393
90 % 54 94 362
70 % 54 95 397
50 % 71 170 280
40 % 71 171 289
30 % 71 171 314
Entity #24 | Chains: c
60S ribosomal protein L17-A protein, length: 184 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 98 239
95 % 53 98 331
90 % 53 99 335
70 % 53 99 379
50 % 71 180 251
40 % 71 180 268
30 % 71 180 288
Entity #25 | Chains: d
60S ribosomal protein L18-A protein, length: 186 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 95 253
95 % 54 95 344
90 % 54 96 350
70 % 54 96 390
50 % 70 171 287
40 % 70 176 285
30 % 70 176 309
Entity #26 | Chains: e
60S ribosomal protein L19-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 51 89 282
95 % 51 89 383
90 % 51 89 399
70 % 51 91 425
50 % 69 169 289
40 % 69 170 298
30 % 69 170 321
Entity #27 | Chains: f
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 93 267
95 % 53 93 363
90 % 53 94 374
70 % 53 94 406
50 % 69 161 318
40 % 70 162 321
30 % 70 163 334
Entity #28 | Chains: g
60S ribosomal protein L21-A protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 276
95 % 54 89 373
90 % 54 90 385
70 % 54 90 426
50 % 70 160 319
40 % 70 166 315
30 % 72 173 306
Entity #29 | Chains: h
60S ribosomal protein L22-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 38 68 432
95 % 38 68 585
90 % 38 68 612
70 % 38 68 655
50 % 38 68 688
40 % 38 68 713
30 % 39 69 720
Entity #3 | Chains: C
5.8S rRNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #30 | Chains: i
60S ribosomal protein L23-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 244
95 % 54 96 343
90 % 54 97 348
70 % 72 182 235
50 % 72 183 242
40 % 72 183 256
30 % 72 183 275
Entity #31 | Chains: j
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 40 63 437
95 % 40 63 590
90 % 40 63 619
70 % 40 63 659
50 % 40 63 695
40 % 44 105 480
30 % 44 105 509
Entity #32 | Chains: k
60S ribosomal protein L25 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 39 73 400
95 % 39 73 527
90 % 39 73 556
70 % 39 73 591
50 % 39 73 630
40 % 39 75 652
30 % 39 76 681
Entity #33 | Chains: l
60S ribosomal protein L26-A protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 100 234
95 % 54 100 320
90 % 54 101 328
70 % 54 101 371
50 % 71 180 250
40 % 71 180 267
30 % 71 180 287
Entity #34 | Chains: m
60S ribosomal protein L27-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 284
95 % 53 89 385
90 % 53 90 389
70 % 53 90 431
50 % 69 156 331
40 % 70 169 299
30 % 71 171 318
Entity #35 | Chains: n
60S ribosomal protein L28 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 87 296
95 % 54 90 371
90 % 54 91 380
70 % 54 91 417
50 % 71 173 272
40 % 72 174 284
30 % 72 176 300
Entity #36 | Chains: o
60S ribosomal protein L29 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 81 314
95 % 53 81 419
90 % 53 82 437
70 % 53 82 481
50 % 53 82 508
40 % 53 82 538
30 % 53 82 566
Entity #37 | Chains: p
60S ribosomal protein L30 protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 56 95 249
95 % 56 95 342
90 % 56 96 347
70 % 56 96 388
50 % 74 179 252
40 % 74 179 270
30 % 74 179 290
Entity #38 | Chains: q
60S ribosomal protein L31-A protein, length: 113 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 93 263
95 % 54 93 355
90 % 54 93 368
70 % 54 94 399
50 % 71 170 281
40 % 71 170 296
30 % 71 170 319
Entity #39 | Chains: r
60S ribosomal protein L32 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 243
95 % 54 96 341
90 % 54 96 352
70 % 54 97 387
50 % 72 174 266
40 % 72 178 273
30 % 72 179 293
Entity #4 | Chains: Y
Tyrosine-protein phosphatase YVH1 protein, length: 364 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 4 5 18677
95 % 4 5 16582
90 % 4 5 17066
70 % 4 5 15239
50 % 4 5 14410
40 % 4 5 12811
30 % 4 5 12206
Entity #40 | Chains: s
60S ribosomal protein L33-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 94 264
95 % 53 94 358
90 % 53 94 372
70 % 53 95 400
50 % 69 166 303
40 % 70 168 311
30 % 70 168 330
Entity #41 | Chains: t
60S ribosomal protein L34-A protein, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 290
95 % 53 89 389
90 % 53 89 406
70 % 53 90 439
50 % 69 155 334
40 % 69 155 345
30 % 69 155 359
Entity #42 | Chains: u
60S ribosomal protein L35-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 99 235
95 % 54 99 321
90 % 54 99 331
70 % 54 100 373
50 % 70 172 285
40 % 71 183 254
30 % 72 185 266
Entity #43 | Chains: v
60S ribosomal protein L36-A protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 90 280
95 % 53 94 357
90 % 53 94 371
70 % 53 95 402
50 % 53 95 456
40 % 70 163 318
30 % 70 173 311
Entity #44 | Chains: w
60S ribosomal protein L37-A protein, length: 88 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 96 247
95 % 54 96 339
90 % 54 96 353
70 % 58 132 311
50 % 71 178 258
40 % 71 178 274
30 % 71 178 295
Entity #45 | Chains: x
60S ribosomal protein L38 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 53 89 288
95 % 53 89 384
90 % 53 89 401
70 % 53 90 430
50 % 53 90 472
40 % 54 97 471
30 % 54 97 497
Entity #46 | Chains: y
60S ribosomal protein L39 protein, length: 51 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 92 271
95 % 54 92 367
90 % 54 92 376
70 % 70 161 269
50 % 71 174 269
40 % 71 176 278
30 % 72 177 298
Entity #47 | Chains: z
Ubiquitin-60S ribosomal protein L40 protein, length: 128 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 31 1541
95 % 9 31 2061
90 % 10 54 1111
70 % 10 57 1070
50 % 10 57 1108
40 % 10 57 1140
30 % 10 57 1182
Entity #48 | Chains: L
Ribosomal protein L12 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 4 24926
95 % 3 4 21896
90 % 3 4 21259
70 % 3 4 19591
50 % 13 64 1061
40 % 13 64 1095
30 % 13 64 1133
Entity #5 | Chains: X
Eukaryotic translation initiation factor 6 protein, length: 245 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 15 31 1714
95 % 15 31 2253
90 % 15 31 2308
70 % 16 32 2298
50 % 18 36 1825
40 % 18 36 1871
30 % 19 38 1739
Entity #6 | Chains: W
Large subunit GTPase 1 protein, length: 640 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 6 7 12692
95 % 6 7 12597
90 % 6 8 10793
70 % 6 8 10354
50 % 6 8 9575
40 % 6 8 9097
30 % 6 8 8459
Entity #7 | Chains: V
60S ribosomal export protein NMD3 protein, length: 518 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 9 11 7112
95 % 9 11 7731
90 % 9 11 7714
70 % 9 11 7446
50 % 9 11 7015
40 % 9 11 6889
30 % 9 11 6466
Entity #8 | Chains: D
60S ribosomal protein L2-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 89 281
95 % 54 89 381
90 % 54 90 387
70 % 70 159 274
50 % 71 172 274
40 % 139 243 197
30 % 139 243 207
Entity #9 | Chains: E
60S ribosomal protein L3 protein, length: 387 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 52 93 274
95 % 54 95 348
90 % 54 96 355
70 % 54 96 394
50 % 73 183 240
40 % 73 183 252
30 % 73 185 265

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 40 BB, DB 60S ribosomal protein L3 4932
2 4U4R 40 L3, l3 60S ribosomal protein L3 4932
3 4U3U 40 L3, l3 60S ribosomal protein L3 4932
4 5TBW 5 CE, k 60S ribosomal protein L3 4932
5 4U3M 40 L3, l3 60S ribosomal protein L3 4932
6 4U3N 40 L3, l3 60S ribosomal protein L3 4932
7 4U52 40 L3, l3 60S ribosomal protein L3 4932
8 4U4Q 40 L3, l3 60S ribosomal protein L3 4932
9 4U6F 40 L3, l3 60S ribosomal protein L3 4932
10 4U4U 40 L3, l3 60S ribosomal protein L3 4932
11 4U4Z 40 L3, l3 60S ribosomal protein L3 4932
12 4U4Y 40 L3, l3 60S ribosomal protein L3 4932
13 4U4N 40 L3, l3 60S ribosomal protein L3 4932
14 4U55 40 L3, l3 60S ribosomal protein L3 4932
15 5DAT 40 L3, l3 60S ribosomal protein L3 4932
16 5I4L 40 L3, l3 60S ribosomal protein L3 4932
17 4U51 40 L3, l3 60S ribosomal protein L3 4932
18 6HHQ 5 CE, k 60S ribosomal protein L3 4932
19 5OBM 5 L3, l3 60S ribosomal protein L3 4932
20 4U53 40 L3, l3 60S ribosomal protein L3 4932
21 5ON6 5 CE, k 60S ribosomal protein L3 4932
22 4U50 40 L3, l3 60S ribosomal protein L3 4932
23 5NDV 5 L3, l3 60S ribosomal protein L3 4932
24 5LYB 40 L3, l3 60S ribosomal protein L3 4932
25 4U56 40 L3, l3 60S ribosomal protein L3 4932
26 5TGA 40 L3, l3 60S ribosomal protein L3 4932
27 5MEI 5 CE, k 60S ribosomal protein L3 4932
28 5FCJ 40 L3, l3 60S ribosomal protein L3 There is one mutation (W255C). The original sequence is: SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDT PPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVL VHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRK THRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDF IMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 4932
29 4U4O 40 L3, l3 60S ribosomal protein L3 4932
30 5DGV 40 L3, l3 60S ribosomal protein L3 4932
31 5DGE 40 L3, l3 60S ribosomal protein L3 4932
32 5NDW 28 L3, l3 60S ribosomal protein L3 4932
33 4V8P 23 BB, CB, EB, GB RIBOSOMAL PROTEIN L3 5911
34 5NDG 40 L3, l3 60S ribosomal protein L3 4932
35 5FCI 40 L3, l3 60S ribosomal protein L3 4932
36 5DC3 40 L3, l3 60S ribosomal protein L3 4932
37 5DGF 40 L3, l3 60S ribosomal protein L3 4932
38 5TGM 40 L3, l3 60S ribosomal protein L3 4932
39 4V7R 34 BC, DC 60S ribosomal protein L3 4932
40 6S47 5 AE 60S ribosomal protein L3 4932
41 6RZZ 3 C 60S ribosomal protein L3 4932
42 6S05 3 C 60S ribosomal protein L3 4932
43 6P5I 40 AB uL3 9986
44 6P5J 40 AB uL3 9986
45 6P5K 5 AB uL3 9986
46 6P5N 5 AB uL3 9986
47 6RM3 7 LB0 uL3 6039
48 6RI5 3 C 60S ribosomal protein L3 4932
49 6OM7 36 B 60S ribosomal protein L3 9606
50 6OLZ 3 AB 60S ribosomal protein L3 9606
51 6OM0 36 B 60S ribosomal protein L3 9606
52 6OLE 36 B 60S ribosomal protein L3 9606
53 6OLF 36 B 60S ribosomal protein L3 9606
54 6OLG 3 AB 60S ribosomal protein L3 9606
55 6OLI 36 B 60S ribosomal protein L3 9606
56 6R84 42 F 60S ribosomal protein L3 4932
57 6R86 40 F 60S ribosomal protein L3 4932
58 6R87 41 F 60S ribosomal protein L3 4932
59 6R7Q 30 B uL3 9986
60 6R6G 13 B uL3 9986
61 6R6P 5 B uL3 9986
62 6R5Q 8 B uL3 9986
63 6QZP 5 LB 60S ribosomal protein L3 9606
64 6QTZ 3 C 60S ribosomal protein L3 4932
65 6QT0 3 C 60S ribosomal protein L3 4932
66 6QKL 2 A 60S ribosomal protein L3 44689
67 6QIK 3 C 60S ribosomal protein L3 4932
68 6Q8Y 38 BA 60S ribosomal protein L3 4932
69 6N8J 5 B 60S ribosomal protein L3 4932
70 6N8K 5 B 60S ribosomal protein L3 4932
71 6N8L 5 B 60S ribosomal protein L3 4932
72 6N8M 6 E 60S ribosomal protein L3 4932
73 6N8N 9 E 60S ribosomal protein L3 4932
74 6N8O 10 E 60S ribosomal protein L3 4932
75 6I7O 5 BA, YA 60S ribosomal protein L3 4932
76 6IP5 5 1E 60S ribosomal protein L3 9606
77 6IP6 5 1E 60S ribosomal protein L3 9606
78 6IP8 5 1E 60S ribosomal protein L3 9606
79 6MTB 8 B 60S ribosomal protein L3 9986
80 6MTC 6 B 60S ribosomal protein L3 9986
81 6MTD 5 B uL3 9986
82 6MTE 5 B uL3 9986
83 6HD7 9 F 60S ribosomal protein L3 4932
84 6HCQ 39 B3 uL3 9986
85 6HCJ 39 B3 uL3 9986
86 6HCM 41 B3 uL3 9986
87 6HCF 41 B3 uL3 9986
88 6GZ3 42 AB ribosomal protein uL3 9986
89 6GZ4 3 AB ribosomal protein uL3 9986
90 6GZ5 42 AB ribosomal protein uL3 9986
91 6GQV 7 B 60S ribosomal protein L3 4932
92 6GQ1 7 B 60S ribosomal protein L3 4932
93 6GQB 7 B 60S ribosomal protein L3 4932
94 6D9J 2 B uL3 9986
95 6D90 2 B uL3 9986
96 6FTG 2 B uL3 9986
97 6FTI 2 B uL3 9986
98 6FTJ 2 B uL3 9986
99 6FT6 3 B 60S ribosomal protein L3 4932
100 6FRK 10 B Ribosomal protein uL3 9986
101 5Z3G 6 F 60S ribosomal protein L3 4932
102 6C0F 5 B 60S ribosomal protein L3 4932
103 6EM1 16 B 60S ribosomal protein L3 4932
104 6EM4 11 B 60S ribosomal protein L3 Backbone model 4932
105 6EM5 27 B 60S ribosomal protein L3 Backbone model 4932
106 6ELZ 28 B 60S ribosomal protein L3 4932
107 6EK0 5 LB 60S ribosomal protein L3 9606
108 6AZ3 2 B ribosomal protein uL3 5661
109 5XY3 5 B Uncharacterized protein 5722
110 5XXB 5 B Ribosomal protein uL3 5811
111 5UMD 5 E 60S ribosomal protein L3 5833
112 5MC6 67 BA 60S ribosomal protein L3 4932
113 5H4P 5 B 60S ribosomal protein L3 4932
114 5M1J 42 B5 60S ribosomal protein L3 4932
115 5LZS 2 B uL3 9986
116 5LZT 2 B uL3 9986
117 5LZU 2 B uL3 9986
118 5LZV 2 B uL3 9986
119 5LZW 2 B uL3 9986
120 5LZX 2 B Ul3 9986
121 5LZY 2 B uL3 9986
122 5LZZ 2 B uL3 9986
123 5T62 6 E 60S ribosomal protein L3 4932
124 5T6R 5 E 60S ribosomal protein L3 4932
125 5T5H 29 f Ribosomal protein L13 5693
126 5T2A 30 d uL3 5661
127 5T2C 4 E 60S ribosomal protein L3 9606
128 5LKS 5 LB 60S ribosomal protein L3 9606
129 5JUO 7 G uL3 (yeast L3) 4932
130 5JUP 7 G uL3 (yeast L3) 4932
131 5JUS 7 G uL3 (yeast L3) 4932
132 5JUT 7 G uL3 (yeast L3) 4932
133 5JUU 7 G uL3 (yeast L3) 4932
134 5JCS 3 B 60S ribosomal protein L3 4932
135 5IT7 5 BB 60S ribosomal protein L3 28985
136 3JCT 2 B 60S ribosomal protein L3 4932
137 3JCS 10 B ribosomal protein L3 5661
138 5GAK 17 F 60S ribosomal protein L3 4932
139 5FL8 2 B 60S ribosomal protein L3 4932
140 5APN 5 B 60S ribosomal protein L3 4932
141 5APO 5 B 60S ribosomal protein L3 4932
142 3JBN 70 AE 60S ribosomal protein uL3 5833
143 3JBO 70 AE 60S ribosomal protein uL3 5833
144 3JBP 70 AE 60S ribosomal protein uL3 5833
145 5AN9 1 A 60S RIBOSOMAL PROTEIN L3 44689
146 5ANB 1 A 60S RIBOSOMAL PROTEIN L3 44689
147 5ANC 1 A 60S RIBOSOMAL PROTEIN L3 44689
148 3JAN 35 B Ribosomal protein uL3 SEE REMARK 999 9986
149 3JAJ 35 B Ribosomal protein uL3 SEE REMARK 999 9986
150 3JAG 2 B uL3 9986
151 3JAH 2 B uL3 9986
152 3JAI 2 B uL3 9986
153 4UG0 5 LB 60S RIBOSOMAL PROTEIN L3 9606
154 5AJ0 4 AB 60S ribosomal protein L3 9606
155 3J92 2 B uL3 9986
156 4D67 2 B 60S RIBOSOMAL PROTEIN L3 9986
157 4D5Y 2 B 60S RIBOSOMAL PROTEIN UL3 9986
158 4V3P 80 LC Ribosomal protein L3 4565
159 3J7O 5 B Ribosomal protein uL3 9823
160 3J7P 5 B Ribosomal protein uL3 9823
161 3J7Q 5 B Ribosomal protein uL3 9823
162 3J7R 5 B Ribosomal protein uL3 9823
163 4UJC 8 BB 60S RIBOSOMAL PROTEIN L3 9986
164 4UJD 5 AB 60S RIBOSOMAL PROTEIN L3 9986
165 3J79 5 E 60S ribosomal protein uL3 5833
166 3J77 3 L3 60S ribosomal protein L3 4932
167 3J78 3 L3 60S ribosomal protein L3 4932
168 3J6X 6 L3 60S ribosomal protein L3 4932
169 3J6Y 6 L3 60S ribosomal protein L3 4932
170 4UJE 39 CB 60S RIBOSOMAL PROTEIN L3 9986
171 4V91 5 B UL3 RIBOSOMAL PROTEIN UL3 28985
172 4V7F 6 C 60S ribosomal protein L3 4932
173 4V7E 71 CB 60S ribosomal protein L3 4565
174 4V8Y 36 BB 60S RIBOSOMAL PROTEIN L3 4932
175 4V8Z 36 BB 60S RIBOSOMAL PROTEIN L3 4932
176 4V6W 63 CB 60S ribosomal protein L3 7227
177 4V6X 63 CB 60S ribosomal protein L3 9606
178 4V8M 65 Bf RIBOSOMAL PROTEIN L3, MITOCHONDRIAL, PUTATIVE 185431
179 4V8T 2 B 60S RIBOSOMAL PROTEIN L3 4932
180 4V6I 32 BC 60S ribosomal protein rpL3 (L3p) 4932
181 4V7H 27 BC 60S ribosomal protein L3 5541
182 4V5Z 54 Bb 60S Ribosomal protein L3 9612
183 4V4B 22 BC 60S ribosomal protein L3 4932