3J9Y

Cryo-EM structure of tetracycline resistance protein TetM bound to a translating E.coli ribosome


Sequence Similarity Clusters for the Entities in PDB 3J9Y

Entity #1 | Chains: a
16S ribosomal RNA rna, length: 1539 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: p
30S ribosomal protein S16 protein, length: 82 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 141 182 159
95 % 141 182 203
90 % 141 182 214
70 % 141 182 240
50 % 145 186 246
40 % 145 186 256
30 % 145 186 276
Entity #11 | Chains: q
30S ribosomal protein S17 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 140 181 151
95 % 140 181 193
90 % 140 181 204
70 % 144 185 220
50 % 158 203 212
40 % 158 203 223
30 % 158 203 237
Entity #12 | Chains: r
30S ribosomal protein S18 protein, length: 75 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 107 127 230
95 % 109 131 293
90 % 109 131 307
70 % 111 133 345
50 % 111 133 409
40 % 111 133 429
30 % 111 133 450
Entity #13 | Chains: t
30S ribosomal protein S20 protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 140 180 158
95 % 140 180 199
90 % 140 180 209
70 % 140 180 235
50 % 144 184 240
40 % 167 208 220
30 % 167 208 233
Entity #14 | Chains: u
30S ribosomal protein S21 protein, length: 71 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 108 126 231
95 % 108 126 308
90 % 108 126 321
70 % 110 128 357
50 % 110 128 425
40 % 110 128 442
30 % 110 128 465
Entity #15 | Chains: v
P-site fMet-tRNAfMet rna, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #16 | Chains: x
mRNA rna, length: 11 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #17 | Chains: w
Tetracycline resistance protein TetM protein, length: 639 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 49848
95 % 2 3 27667
90 % 2 3 25536
70 % 2 4 20991
50 % 2 4 18817
40 % 2 4 15817
30 % 2 4 15555
Entity #18 | Chains: c
30S ribosomal protein S3 protein, length: 233 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 82 388
95 % 63 83 512
90 % 63 83 534
70 % 63 83 569
50 % 335 362 87
40 % 335 362 103
30 % 335 362 103
Entity #19 | Chains: g
30S ribosomal protein S7 protein, length: 179 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 51 71 447
95 % 139 178 214
90 % 139 178 223
70 % 51 71 660
50 % 51 71 692
40 % 51 71 716
30 % 51 71 764
Entity #2 | Chains: b
30S ribosomal protein S2 protein, length: 240 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 138 177 161
95 % 138 177 208
90 % 138 177 219
70 % 142 181 232
50 % 487 537 31
40 % 492 543 38
30 % 492 543 41
Entity #20 | Chains: i
30S ribosomal protein S9 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 139 180 156
95 % 139 180 197
90 % 139 180 208
70 % 143 184 224
50 % 483 534 32
40 % 483 534 41
30 % 483 534 44
Entity #21 | Chains: j
30S ribosomal protein S10 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 183 147
95 % 144 184 187
90 % 148 188 195
70 % 148 188 215
50 % 496 545 26
40 % 496 545 35
30 % 527 578 34
Entity #22 | Chains: m
30S ribosomal protein S13 protein, length: 118 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 142 184 152
95 % 142 184 192
90 % 142 184 203
70 % 146 188 222
50 % 492 545 28
40 % 495 548 37
30 % 495 548 40
Entity #23 | Chains: n
30S ribosomal protein S14 protein, length: 102 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 25 26 2108
95 % 139 177 209
90 % 139 177 218
70 % 139 177 242
50 % 145 183 244
40 % 150 189 239
30 % 151 190 250
Entity #24 | Chains: s
30S ribosomal protein S19 protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 138 178 160
95 % 138 178 206
90 % 138 178 216
70 % 144 184 227
50 % 494 546 25
40 % 494 546 34
30 % 494 546 38
Entity #25 | Chains: A
23S ribosomal RNA rna, length: 2903 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #26 | Chains: B
5S ribosomal RNA rna, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #27 | Chains: C
50S ribosomal protein L2 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 146 190 141
95 % 146 190 181
90 % 146 190 192
70 % 150 194 199
50 % 419 470 47
40 % 419 470 60
30 % 419 470 61
Entity #28 | Chains: D
50S ribosomal protein L3 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 155 202 123
95 % 155 202 158
90 % 155 202 173
70 % 159 206 183
50 % 423 476 48
40 % 427 480 55
30 % 427 481 57
Entity #29 | Chains: E
50S ribosomal protein L4 protein, length: 201 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 193 131
95 % 147 193 167
90 % 147 193 181
70 % 147 193 206
50 % 151 197 223
40 % 409 461 69
30 % 410 462 68
Entity #3 | Chains: d
30S ribosomal protein S4 protein, length: 206 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 141 181 153
95 % 141 181 195
90 % 141 181 206
70 % 145 185 223
50 % 472 521 34
40 % 500 551 33
30 % 500 551 37
Entity #30 | Chains: F
50S ribosomal protein L5 protein, length: 179 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 148 197 128
95 % 148 197 159
90 % 148 197 176
70 % 148 197 204
50 % 411 465 50
40 % 411 465 63
30 % 411 465 64
Entity #31 | Chains: G
50S ribosomal protein L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 146 192 134
95 % 146 192 174
90 % 146 192 187
70 % 146 192 209
50 % 184 238 185
40 % 414 471 57
30 % 414 471 58
Entity #32 | Chains: H
50S ribosomal protein L9 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 132 175 166
95 % 133 176 219
90 % 133 176 230
70 % 133 176 253
50 % 134 177 280
40 % 309 355 101
30 % 322 368 96
Entity #33 | Chains: I
50S ribosomal protein L11 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 116 166 168
95 % 116 166 223
90 % 116 166 234
70 % 120 170 259
50 % 189 266 154
40 % 189 266 170
30 % 191 274 169
Entity #34 | Chains: J
50S ribosomal protein L13 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 194 127
95 % 147 194 162
90 % 147 194 177
70 % 151 198 186
50 % 190 240 184
40 % 390 443 74
30 % 390 443 77
Entity #35 | Chains: K
50S ribosomal protein L14 protein, length: 123 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 195 122
95 % 147 195 157
90 % 147 195 172
70 % 151 199 184
50 % 424 483 40
40 % 424 483 50
30 % 424 483 51
Entity #36 | Chains: L
50S ribosomal protein L15 protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 146 193 130
95 % 147 194 161
90 % 147 194 175
70 % 147 194 200
50 % 151 198 219
40 % 412 465 65
30 % 412 465 66
Entity #37 | Chains: M
50S ribosomal protein L16 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 132 178 164
95 % 144 190 180
90 % 144 190 191
70 % 148 194 202
50 % 416 468 49
40 % 416 468 61
30 % 416 468 62
Entity #38 | Chains: N
50S ribosomal protein L17 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 141 187 144
95 % 147 193 166
90 % 147 193 182
70 % 151 197 191
50 % 379 428 59
40 % 415 467 54
30 % 415 469 55
Entity #39 | Chains: O
50S ribosomal protein L18 protein, length: 117 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 145 191 135
95 % 145 191 176
90 % 145 191 188
70 % 145 191 212
50 % 399 450 57
40 % 399 450 76
30 % 399 450 78
Entity #4 | Chains: e
30S ribosomal protein S5 protein, length: 167 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 141 169 165
95 % 141 182 191
90 % 141 182 202
70 % 145 186 217
50 % 488 541 29
40 % 488 541 39
30 % 488 541 42
Entity #40 | Chains: P
50S ribosomal protein L19 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 193 132
95 % 147 193 169
90 % 147 193 185
70 % 151 197 190
50 % 197 246 178
40 % 197 246 192
30 % 197 246 199
Entity #41 | Chains: Q
50S ribosomal protein L20 protein, length: 118 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 194 125
95 % 147 194 164
90 % 147 194 179
70 % 151 198 185
50 % 417 470 45
40 % 424 478 52
30 % 424 478 53
Entity #42 | Chains: R
50S ribosomal protein L21 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 190 138
95 % 147 190 178
90 % 147 190 190
70 % 147 190 214
50 % 151 194 227
40 % 416 465 64
30 % 416 465 65
Entity #43 | Chains: S
50S ribosomal protein L22 protein, length: 110 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 193 133
95 % 147 193 168
90 % 147 193 183
70 % 147 193 207
50 % 385 439 58
40 % 385 439 77
30 % 385 439 79
Entity #44 | Chains: T
50S ribosomal protein L23 protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 197 119
95 % 147 197 151
90 % 147 197 165
70 % 147 197 189
50 % 151 201 215
40 % 414 471 58
30 % 414 471 59
Entity #45 | Chains: U
50S ribosomal protein L24 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 196 121
95 % 147 196 156
90 % 147 196 170
70 % 147 196 196
50 % 388 443 55
40 % 388 443 75
30 % 388 445 76
Entity #46 | Chains: V
50S ribosomal protein L25 protein, length: 94 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 146 197 118
95 % 146 197 152
90 % 146 197 166
70 % 146 197 192
50 % 147 198 211
40 % 147 198 222
30 % 147 198 236
Entity #47 | Chains: W
50S ribosomal protein L27 protein, length: 85 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 146 192 137
95 % 147 193 172
90 % 147 193 186
70 % 176 222 173
50 % 417 467 46
40 % 417 467 59
30 % 417 467 60
Entity #48 | Chains: X
50S ribosomal protein L28 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 141 177 163
95 % 141 177 215
90 % 141 177 225
70 % 145 181 241
50 % 147 183 249
40 % 147 183 263
30 % 147 183 286
Entity #49 | Chains: Y
50S ribosomal protein L29 protein, length: 63 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 197 120
95 % 147 197 153
90 % 147 197 167
70 % 147 197 193
50 % 151 201 216
40 % 343 396 88
30 % 369 422 84
Entity #5 | Chains: f
30S ribosomal protein S6 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 61 81 395
95 % 63 83 511
90 % 63 83 535
70 % 63 83 568
50 % 63 83 606
40 % 63 83 637
30 % 63 83 668
Entity #50 | Chains: Z
50S ribosomal protein L30 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 194 124
95 % 147 194 163
90 % 147 194 178
70 % 147 194 201
50 % 203 252 175
40 % 406 460 67
30 % 406 460 70
Entity #51 | Chains: 0
50S ribosomal protein L32 protein, length: 57 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 191 136
95 % 147 191 175
90 % 147 191 189
70 % 147 191 213
50 % 151 195 226
40 % 151 195 233
30 % 407 457 73
Entity #52 | Chains: 1
50S ribosomal protein L33 protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 144 190 139
95 % 144 190 179
90 % 144 190 193
70 % 148 194 203
50 % 173 219 196
40 % 376 426 82
30 % 376 426 86
Entity #53 | Chains: 2
50S ribosomal protein L34 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 147 189 142
95 % 147 189 183
90 % 147 189 194
70 % 180 222 172
50 % 416 464 52
40 % 416 464 66
30 % 416 464 67
Entity #54 | Chains: 3
50S ribosomal protein L35 protein, length: 65 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 144 186 146
95 % 144 186 185
90 % 144 186 198
70 % 144 186 218
50 % 169 212 204
40 % 406 452 72
30 % 406 452 74
Entity #55 | Chains: 4
50S ribosomal protein L36 protein, length: 38 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 140 184 148
95 % 140 184 189
90 % 140 184 200
70 % 144 188 216
50 % 354 404 79
40 % 354 404 97
30 % 354 404 95
Entity #56 | Chains: 5
50S ribosomal protein L10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 28 40 1143
95 % 33 45 1386
90 % 33 45 1425
70 % 33 45 1467
50 % 33 45 1489
40 % 33 45 1515
30 % 62 75 840
Entity #57 | Chains: 6
50S ribosomal protein L31 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 62 80 506
95 % 62 80 682
90 % 62 80 717
70 % 62 80 759
50 % 62 80 791
40 % 260 281 131
30 % 261 282 138
Entity #58 | Chains: 7
50S ribosomal protein L7/L12 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 24799
95 % 2 4 25080
90 % 2 4 24286
70 % 2 4 22156
50 % 2 4 19554
40 % 2 4 17947
30 % 2 4 16112
Entity #6 | Chains: h
30S ribosomal protein S8 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 141 182 149
95 % 141 182 188
90 % 141 182 199
70 % 141 182 229
50 % 497 550 24
40 % 502 556 31
30 % 667 752 23
Entity #7 | Chains: k
30S ribosomal protein S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 139 180 155
95 % 139 180 201
90 % 139 180 211
70 % 139 180 236
50 % 487 539 30
40 % 487 539 40
30 % 487 539 43
Entity #8 | Chains: l
30S ribosomal protein S12 protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 109 154 184
95 % 137 182 194
90 % 137 182 205
70 % 481 543 17
50 % 498 561 22
40 % 498 561 29
30 % 498 561 35
Entity #9 | Chains: o
30S ribosomal protein S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 126 150 190
95 % 141 183 190
90 % 141 183 201
70 % 141 183 230
50 % 501 557 23
40 % 501 557 32
30 % 501 557 36

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1SEI 1 A, B RIBOSOMAL PROTEIN S8 1422
2 4YBB 8 AH, BH 30S ribosomal protein S8 562
3 4Y4O 39 1h, 2h 30S ribosomal protein S8 274
4 5J8B 41 h 30S ribosomal protein S8 274
5 1AN7 1 A, B RIBOSOMAL PROTEIN S8 274
6 4W2F 8 AH, CH 30S Ribosomal Protein S8 274
7 6CFL 39 1h, 2h 30S Ribosomal Protein S8 274
8 6CAE 39 1h, 2h 30S ribosomal protein S8 274
9 4Y4P 39 1h, 2h 30S ribosomal protein S8 274
10 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
11 5FDV 40 1h, 2h 30S ribosomal protein S8 274
12 5J4B 39 1h, 2h 30S ribosomal protein S8 274
13 4W2G 8 AH, CH 30S Ribosomal Protein S8 274
14 6CFK 39 1h, 2h 30S ribosomal protein S8 274
15 5J7L 8 AH, BH 30S ribosomal protein S8 562
16 5W4K 39 1h, 2h 30S ribosomal protein S8 274
17 4LFB 8 H ribosomal protein S8 274
18 1VY4 8 AH, CH 30S ribosomal protein S8 274
19 4WOI 8 AH, DH 30S ribosomal protein S8 562
20 5FDU 39 1h, 2h 30S ribosomal protein S8 274
21 6I7V 12 AH, BH 30S ribosomal protein S8 562
22 4W2I 8 AH, CH 30S Ribosomal Protein S8 274
23 5JC9 8 AH, BH 30S ribosomal protein S8 562
24 1VY5 8 AH, CH 30S ribosomal protein S8 274
25 5HCQ 39 1h, 2h 30S ribosomal protein S8 274
26 4WQF 41 BH, DH 30S ribosomal protein S8 274
27 6ND5 39 1h, 2h 30S ribosomal protein S8 274
28 4W2H 8 AH, CH 30S Ribosomal Protein S8 274
29 4WPO 41 BH, DH 30S ribosomal protein S8 274
30 5J8A 8 AH, BH 30S ribosomal protein S8 562
31 4V8I 8 AH, CH 30S Ribosomal Protein S8 274
32 4JI1 8 H RIBOSOMAL PROTEIN S8 274
33 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
34 4Z3S 39 1h, 2h 30S ribosomal protein S8 274
35 5DOY 39 1h, 2h 30S Ribosomal Protein S8 274
36 5J5B 8 AH, BH 30S ribosomal protein S8 562
37 5HD1 39 1h, 2h 30S ribosomal protein S8 274
38 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
39 4DR6 8 H 30S ribosomal protein S8 274
40 4LF7 8 H ribosomal protein S8 274
41 4LF8 8 H ribosomal protein S8 274
42 5WIS 39 1h, 2h 30S ribosomal protein S8 274
43 4WSD 8 72, 7E 30S ribosomal protein S8 274
44 4WQU 41 BH, DH 30S ribosomal protein S8 274
45 5WIT 39 1h, 2h 30S ribosomal protein S8 274
46 5E81 8 72, 7E 30S ribosomal protein S8 274
47 2VQE 8 H 30S RIBOSOMAL PROTEIN S8 274
48 6GSJ 8 72, 7E 30S ribosomal protein S8 274
49 4U27 8 AH, CH 30S ribosomal protein S8 562
50 6OF1 39 1h, 2h 30S ribosomal protein S8 274
51 6CFJ 39 1h, 2h 30S ribosomal protein S8 274
52 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
53 4Z8C 39 1h, 2h 30S ribosomal protein S8 274
54 5HCR 39 1h, 2h 30S ribosomal protein S8 274
55 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
56 2UUB 8 H 30S RIBOSOMAL PROTEIN S8 274
57 4DV6 8 H ribosomal protein S8 274
58 4JYA 8 H 30S ribosomal protein S8 274
59 5IBB 8 72, 7E 30S ribosomal protein S8 274
60 4DR5 8 H 30S ribosomal protein S8 274
61 5J4C 39 1h, 2h 30S ribosomal protein S8 274
62 4KHP 8 H 30S Ribosomal protein S8 274
63 4DR2 8 H 30S ribosomal protein S8 274
64 4WRO 12 7E 30S ribosomal protein S8 274
65 4WQ1 8 72, 7E 30S ribosomal protein S8 274
66 4LF9 8 H ribosomal protein S8 274
67 4WQY 41 BH, DH 30S ribosomal protein S8 274
68 4DUY 8 H ribosomal protein S8 274
69 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
70 4DV7 8 H ribosomal protein S8 274
71 4WRA 8 72, 7E 30S ribosomal protein S8 274
72 1S03 2 G, H 30S ribosomal protein S8 562
73 5IB7 8 72, 7E 30S ribosomal protein S8 274
74 4U26 8 AH, CH 30S ribosomal protein S8 562
75 4X64 8 H 30S ribosomal protein S8 274
76 5HCP 39 1h, 2h 30S ribosomal protein S8 274
77 5IT8 8 AH, BH 30S ribosomal protein S8 562
78 4V9D 8 AH, BH 30S ribosomal protein S8 562
79 4V9P 40 BH, DH, FH, HH 30S ribosomal protein S8 562
80 4V9H 21 AH 30S ribosomal protein S8 274
81 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
82 5J91 8 AH, BH 30S ribosomal protein S8 562
83 4V8D 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
84 5WNT 8 H RIBOSOMAL PROTEIN S8 274
85 4DR3 8 H 30S ribosomal protein S8 274
86 4V90 8 AH 30S RIBOSOMAL PROTEIN S8 274
87 4JI3 8 H RIBOSOMAL PROTEIN S8 274
88 4WQR 8 72, 7E 30S ribosomal protein S8 274
89 4JI6 8 H RIBOSOMAL PROTEIN S8 274
90 4JI8 8 H RIBOSOMAL PROTEIN S8 274
91 2UXC 8 H RIBOSOMAL PROTEIN S8 274
92 5IB8 8 72, 7E 30S ribosomal protein S8 274
93 4V9R 8 AH, CH 30S Ribosomal Protein S8 274
94 4B3M 8 H 30S RIBOSOMAL PROTEIN S8 274
95 5EL6 8 72, 7E 30S ribosomal protein S8 274
96 6O97 39 1h, 2h 30S ribosomal protein S8 274
97 5EL7 8 72, 7E 30S ribosomal protein S8 274
98 5VP2 39 1h, 2h 30S ribosomal protein S8 274
99 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
100 4LF4 8 H ribosomal protein S8 274
101 5DFE 42 QH, XH 30S ribosomal protein S8 274
102 5NDK 50 72, 7E 30S ribosomal protein S8 274
103 4LF6 8 H ribosomal protein S8 274
104 4JI7 8 H RIBOSOMAL PROTEIN S8 274
105 5J88 8 AH, BH 30S ribosomal protein S8 562
106 4U24 8 AH, CH 30S ribosomal protein S8 562
107 4WU1 8 72, 7E 30S ribosomal protein S8 274
108 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
109 6QNR 8 72, 7E 30S ribosomal protein S8 274
110 5EL4 8 72, 7E 30S ribosomal protein S8 274
111 5WNV 8 H 30S ribosomal protein S8 274
112 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
113 4B3T 8 H 30S RIBOSOMAL PROTEIN S8 274
114 4WR6 8 72, 7E 30S ribosomal protein S8 274
115 4V8B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
116 5HAU 41 1h, 2h 30S ribosomal protein S8 274
117 4V9O 41 BH, DH, FH, HH 30S ribosomal protein S8 562
118 6MPF 8 H 30S ribosomal protein S8 274
119 2VQF 8 H 30S RIBOSOMAL PROTEIN S8 274
120 2UUA 8 H 30S RIBOSOMAL PROTEIN S8 274
121 4V87 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
122 4WF1 8 AH, CH 30S ribosomal protein S8 562
123 4U25 8 AH, CH 30S ribosomal protein S8 562
124 4V95 8 AH, CH 30S Ribosomal Protein S8 274
125 4WWW 39 QH, XH 30S ribosomal protein S8 562
126 4V7T 8 AH, CH 30S ribosomal protein S8 562
127 1VY7 8 AH, CH 30S ribosomal protein S8 274
128 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
129 5E7K 8 72, 7E 30S ribosomal protein S8 274
130 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
131 5EL5 8 72, 7E 30S ribosomal protein S8 274
132 6FKR 39 1h, 2h 30S ribosomal protein S8 274
133 4B3R 8 H 30S RIBOSOMAL PROTEIN S8 274
134 4LNT 8 QH, XH 30S ribosomal protein S8 274
135 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
136 4DR1 8 H 30S ribosomal protein S8 274
137 4LFA 8 H ribosomal protein S8 274
138 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
139 4DV4 8 H ribosomal protein S8 274
140 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
141 4YZV 8 QH, XH 30S ribosomal protein S8 274
142 4JI0 8 H ribosomal protein S8 274
143 5IWA 7 H 30S ribosomal protein S8 274
144 4V7U 8 AH, CH 30S ribosomal protein S8 562
145 4V9S 8 AH, CH 30S Ribosomal Protein S8 274
146 4JI2 8 H RIBOSOMAL PROTEIN S8 274
147 4V6C 7 AH, CH 30S ribosomal protein S8 562
148 4JV5 8 H 30S ribosomal protein S8 274
149 4DR7 8 H 30S ribosomal protein S8 274
150 1J5E 8 H 30S RIBOSOMAL PROTEIN S8 274
151 4GKK 8 H 30S ribosomal protein S8 274
152 4DUZ 8 H ribosomal protein S8 274
153 5NDJ 50 72, 7E 30S ribosomal protein S8 274
154 4V7V 8 AH, CH 30S ribosomal protein S8 562
155 4X65 8 H 30S ribosomal protein S8 274
156 4V8G 8 AH, CH 30S Ribosomal Protein S8 274
157 4GKJ 8 H 30S ribosomal protein S8 274
158 4DV3 8 H ribosomal protein S8 274
159 4V7S 8 AH, CH 30S ribosomal protein S8 562
160 4DV5 8 H ribosomal protein S8 274
161 5DAT 24 D2 40S ribosomal protein S22-A 4932
162 5DAT 80 d2 40S ribosomal protein S22-A 4932
163 2UUC 8 H 30S RIBOSOMAL PROTEIN S8 274
164 4LFC 8 H ribosomal protein S8 274
165 1FJG 9 H 30S RIBOSOMAL PROTEIN S8 274
166 3T1Y 8 H 30S ribosomal protein S8 274
167 4WZO 8 72, 7E 30S ribosomal protein S8 274
168 4JI4 8 H RIBOSOMAL PROTEIN S8 274
169 1VY6 8 AH, CH 30S ribosomal protein S8 274
170 1XMQ 10 H 30S Ribosomal Protein S8 274
171 5WNP 8 H 30S ribosomal protein S8 274
172 6CAP 8 H 30S ribosomal protein S8 274
173 4U20 8 AH, CH 30S ribosomal protein S8 562
174 6MPI 8 H 30S ribosomal protein S8 274
175 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
176 4DV0 8 H ribosomal protein S8 274
177 4V9B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
178 4U1V 8 AH, CH 30S ribosomal protein S8 562
179 4V6F 38 BK, CK 30S ribosomal protein S8 274
180 4X62 8 H 30S ribosomal protein S8 274
181 4V8F 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
182 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
183 4B3S 8 H 30S RIBOSOMAL PROTEIN S8 274
184 4DV2 8 H ribosomal protein S8 274
185 4DV1 8 H ribosomal protein S8 274
186 5WNU 8 H 30S ribosomal protein S8 274
187 1N32 10 H 30S RIBOSOMAL PROTEIN S8 274
188 5F8K 39 1h, 2h 30S ribosomal protein S8 274
189 1I94 8 H 30S RIBOSOMAL PROTEIN S8 274
190 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
191 4V8H 8 AH, CH 30S Ribosomal Protein S8 274
192 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
193 4JI5 8 H RIBOSOMAL PROTEIN S8 274
194 6CAQ 8 H 30S ribosomal protein S8 274
195 4K0K 8 H 30S ribosomal protein S8 274
196 4W2E 41 h 30S ribosomal protein S8 274
197 4V8C 38 CK, DK 30S RIBOSOMAL PROTEIN S8 274
198 5BR8 8 H 30S ribosomal protein S8 274
199 4LF5 8 H ribosomal protein S8 274
200 5J4D 42 QA, VC 30S ribosomal protein S8 274
201 4V9A 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
202 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
203 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
204 4V5J 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
205 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
206 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
207 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
208 6ND6 39 1h, 2h 30S ribosomal protein S8 274
209 4V7Y 8 AH, CH 30S ribosomal protein S8 274
210 6UO1 39 1h, 2h 30S ribosomal protein S8 274
211 6GSK 8 72, 7E 30S ribosomal protein S8 274
212 4V9C 8 AH, CH 30S ribosomal protein S8 562
213 4V8E 38 BK, DK 30S RIBOSOMAL PROTEIN S8 274
214 5J30 39 QH, XH 30S ribosomal protein S8 274
215 6QNQ 8 72, 7E 30S ribosomal protein S8 274
216 4DR4 8 H 30S ribosomal protein S8 274
217 4WZD 8 72, 7E 30S ribosomal protein S8 274
218 3OTO 8 H 30S RIBOSOMAL PROTEIN S8 274
219 4X66 8 H 30S ribosomal protein S8 274
220 2UU9 8 H 30S RIBOSOMAL PROTEIN S8 274
221 4V8Q 42 BH 30S RIBOSOMAL PROTEIN S8 274
222 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
223 4V85 8 AH 30S ribosomal protein S8 562
224 1HR0 9 H 30S RIBOSOMAL PROTEIN S8 274
225 4AQY 8 H 30S RIBOSOMAL PROTEIN S8 274
226 4W4G 8 QH, XH 30S ribosomal protein S8 274
227 4NXM 8 H ribosomal protein S8 274
228 4V5L 8 AH 30S RIBOSOMAL PROTEIN S8 274
229 4YPB 8 QH, XH 30S ribosomal protein S8 274
230 4V7X 8 AH, CH 30S ribosomal protein S8 274
231 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
232 4U1U 8 AH, CH 30S ribosomal protein S8 562
233 4ZER 39 1h, 2h 30S ribosomal protein S8 274
234 1IBL 11 H 30S RIBOSOMAL PROTEIN S8 274
235 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
236 4V7W 8 AH, CH 30S ribosomal protein S8 274
237 4WT1 8 72, 7E 30S ribosomal protein S8 274
238 6C5L 8 AH, CH 30S ribosomal protein S8 274
239 4WT8 8 AH, BH 30S ribosomal protein S8 274
240 5DOX 39 1h, 2h 30S ribosomal protein S8 274
241 6OTR 8 QH, XH 30S ribosomal protein S8 274
242 4NXN 8 H ribosomal protein S8 274
243 1XNR 10 H 16S Ribosomal protein S8 274
244 4LT8 8 QH, XH 30S ribosomal protein S8 274
245 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
246 5WNQ 8 H 30S ribosomal protein S8 274
247 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
248 6MKN 8 H 30S ribosomal protein S8 274
249 4V51 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
250 6DTI 8 H 30S ribosomal protein S8 274
251 4V7L 8 AH, CH 30S ribosomal protein S8 274
252 4V5R 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
253 1HNZ 9 H 30S RIBOSOMAL PROTEIN S8 274
254 1XNQ 10 H Ribosomal protein S8 274
255 4V8A 38 CH, DH 30S ribosomal protein S8 274
256 4V5K 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
257 4V5Q 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
258 4V7J 7 Ah, Bh 30S ribosomal protein S8 274
259 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
260 6BZ6 8 QH, XH 30S ribosomal protein S8 274
261 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
262 5J3C 39 QH, XH 30S ribosomal protein S8 274
263 4V5C 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
264 4V5E 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
265 4L47 8 QH, XH 30S ribosomal protein S8 274
266 4V5P 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
267 5V8I 39 1h, 2h 30S ribosomal protein S8 274
268 4ZSN 8 QH, XH 30S ribosomal protein S8 274
269 4V5D 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
270 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
271 6CZR 39 1h, 2h 30S ribosomal protein S8 274
272 6OXA 8 QH, XH 30S ribosomal protein S8 274
273 6BUW 8 QH, XH 30S ribosomal protein S8 274
274 4V7Z 8 AH, CH 30S ribosomal protein S8 274
275 4V8X 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
276 4V5S 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
277 4V9I 8 AH, CH 30S Ribosomal protein S8 274
278 1XMO 10 H 30S ribosomal protein S8 274
279 3T1H 8 H 30S ribosomal protein S8 274
280 2UXD 8 H RIBOSOMAL PROTEIN S8 274
281 1N33 10 H 30S RIBOSOMAL PROTEIN S8 274
282 1IBK 9 H 30S RIBOSOMAL PROTEIN S8 274
283 4V6G 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
284 4V8N 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
285 4V97 8 AH, CH 30S ribosomal protein S8 274
286 6CAR 8 H 30S ribosomal protein S8 274
287 1HNW 9 H 30S RIBOSOMAL PROTEIN S8 274
288 4V7M 8 AH, CH 30S ribosomal protein S8 274
289 4WSM 8 72, 7E 30S ribosomal protein S8 274
290 4TUD 8 QH, XH 30S ribosomal protein S8 274
291 1IBM 11 H 30S RIBOSOMAL PROTEIN S8 274
292 5WNR 8 H 30S ribosomal protein S8 274
293 6CAO 8 H 30S ribosomal protein S8 274
294 4V6A 8 AH, CH 30S ribosomal protein S8 274
295 4TUE 8 QH, XH 30S ribosomal protein S8 274
296 6OXI 8 QH, XH 30S ribosomal protein S8 274
297 4TUA 8 QH, XH 30S ribosomal protein S8 274
298 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
299 4V84 8 AH, CH 30S ribosomal protein S8 274
300 5WNS 8 H 30S ribosomal protein S8 274
301 6NDK 8 QH, XH 30S ribosomal protein S8 274
302 4V7K 7 Ah, Bh 30S ribosomal protein S8 274
303 4YY3 8 H 30S ribosomal protein S8 274
304 1HNX 9 H 30S RIBOSOMAL PROTEIN S8 274
305 4V9Q 38 BH, DH 30S ribosomal protein S8 274
306 6BZ8 8 QH, XH 30S ribosomal protein S8 274
307 4TUC 8 QH, XH 30S ribosomal protein S8 274
308 4YHH 8 H 30S ribosomal protein S8 274
309 5VPO 9 QH, XH 30S ribosomal protein S8 274
310 6NY6 8 H 30S ribosomal protein S8 274
311 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
312 4TUB 8 QH, XH 30S ribosomal protein S8 274
313 4V9N 11 AH, CH 30S ribosomal protein S8 274
314 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
315 4P70 8 QH, XH 30S ribosomal protein S8 274
316 4V8U 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
317 4LSK 8 QH, XH 30S ribosomal protein S8 274
318 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
319 4V6D 7 AH, CH 30S ribosomal protein S8 562
320 4P6F 8 QH, XH 30S ribosomal protein S8 274
321 4V67 10 AH, CH 30S ribosomal protein S8 274
322 4V83 8 AH, CH 30S ribosomal protein S8 274
323 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
324 4V5F 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
325 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
326 1VVJ 8 QH, XH 30S ribosomal protein S8 274
327 4LFZ 8 QH, XH 30S ribosomal protein S8 274
328 2E5L 9 H 30S ribosomal protein S8 274
329 6BZ7 8 QH, XH 30S ribosomal protein S8 274
330 6N1D 42 AS08, BS08 30S ribosomal protein S8 274
331 4V6E 7 AH, CH 30S ribosomal protein S8 562
332 6UCQ 38 1h, 2h 30S ribosomal protein S8 274
333 6CAS 8 H 30S ribosomal protein S8 274
334 4V52 7 AH, CH 30S ribosomal protein S8 562
335 5CZP 39 QH, XH 30S ribosomal protein S8 274
336 6N9F 39 1h, 2h 30S Ribosomal Protein S8 274
337 6N9E 39 1h, 2h 30S Ribosomal Protein S8 274
338 2HHH 8 H 30S ribosomal protein S8 274
339 4V89 8 AH 30S ribosomal protein S8 562
340 4OX9 8 H 30S ribosomal protein S8 274
341 4V54 7 AH, CH 30S ribosomal protein S8 562
342 2UXB 8 H RIBOSOMAL PROTEIN S8 274
343 1I96 8 H 30S RIBOSOMAL PROTEIN S8 274
344 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
345 4V9K 7 AH, CH 30S ribosomal protein S8 274
346 4V50 10 AH, CH 30S ribosomal protein S8 562
347 1N34 9 H 30S RIBOSOMAL PROTEIN S8 274
348 4V57 7 AH, CH 30S ribosomal protein S8 562
349 4V5A 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
350 4V63 10 AH, CH 30S ribosomal protein S8 274
351 4L71 8 QH, XH 30S ribosomal protein S8 274
352 4KVB 8 H 30S ribosomal protein S8 274
353 4XEJ 35 AS08, BS08 30S ribosomal protein S8 274
354 4V64 7 AH, CH 30S ribosomal protein S8 562
355 4V7P 8 AH, DH 30S ribosomal protein S8 274
356 4V8J 8 AH, CH 30S ribosomal protein S8 274
357 1N36 8 H 30S RIBOSOMAL PROTEIN S8 274
358 2ZM6 8 H 30S ribosomal protein S8 274
359 4V4H 7 AH, CH 30S RIBOSOMAL PROTEIN S8 562
360 4V4Q 7 AH, CH 30S ribosomal protein S8 562
361 4V5B 40 BH, DH 30S RIBOSOMAL PROTEIN S8 RESIDUES 2-130 562
362 5D8B 35 EC, IA 30S ribosomal protein S8 274
363 6BY1 43 AH, BH 30S ribosomal protein S8 562
364 4LEL 8 QH, XH 30S ribosomal protein S8 274
365 4V53 7 AH, CH 30S ribosomal protein S8 562
366 2F4V 9 H 30S ribosomal protein S8 274
367 4V9L 7 AH, CH 30S ribosomal protein S8 274
368 1FKA 8 H 30S RIBOSOMAL PROTEIN S8 274
369 4V5G 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
370 4V56 7 AH, CH 30S ribosomal protein S8 562
371 1I97 8 H 30S RIBOSOMAL PROTEIN S8 274
372 4V9J 7 AH, CH 30S ribosomal protein S8 274
373 4V55 7 AH, CH 30S ribosomal protein S8 562
374 1I95 8 H 30S RIBOSOMAL PROTEIN S8 274
375 4V8O 8 AH 30S RIBOSOMAL PROTEIN S8 274
376 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
377 4V9M 7 AH, CH 30S ribosomal protein S8 274
378 4W29 7 AH, CH 30S ribosomal protein S8 274
379 4V5Y 7 AH, CH 30S ribosomal protein S8 562
380 4V4Y 10 AK 30S ribosomal protein S8 274
381 4V4J 41 i 30S ribosomal protein S8 274
382 4V4X 10 AK 30S ribosomal protein S8 274
383 4V4Z 11 AK 30S ribosomal protein S8 274
384 4V4I 41 i 30S ribosomal protein S8 274
385 4V4P 43 BK 30S ribosomal protein S8 274
386 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
387 4V4R 11 AH 30S ribosomal protein S8 274
388 4V4S 11 AH 30S ribosomal protein S8 274
389 4V4T 11 AH 30S ribosomal protein S8 274
390 4KZZ 23 W 40S Ribosomal Protein S15A 9986
391 4KZX 23 W 40S ribosomal protein S15A 9986
392 4KZY 23 W 40S Ribosomal Protein S15A 9986
393 4V49 10 AH 30S ribosomal protein S8 562
394 4V4A 8 AH 30S ribosomal protein S8 562
395 4V4G 8 AH, CH, EH, GH, IH 30S ribosomal protein S8 562
396 6UZ7 70 W 40S ribosomal protein S22 28985
397 6TC3 8 S081 30S ribosomal protein S8 562
398 6TBV 8 S081 30S ribosomal protein S8 562
399 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
400 6T7T 24 SW 40S ribosomal protein S22-A 4932
401 6T7I 24 SW 40S ribosomal protein S22-A 4932
402 6T4Q 23 SW 40S ribosomal protein S22-A 4932
403 6SZS 39 h 30S ribosomal protein S8 562
404 6SPC 8 h 30S ribosomal protein S8 287
405 6SPE 8 h 30S ribosomal protein S8 287
406 6SPF 40 h 30S ribosomal protein S8 287
407 6SPG 8 h 30S ribosomal protein S8 287
408 6SGC 24 X1 Ribosomal protein S15a 9986
409 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
410 6S0X 38 h 30S ribosomal protein S8 1280
411 6S13 38 h 30S ribosomal protein S8 1280
412 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
413 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
414 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
415 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
416 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
417 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
418 6P5I 24 X uS8 9986
419 6P5J 24 X uS8 9986
420 6P5K 70 X uS8 9986
421 6P5N 70 X uS8 9986
422 6P4G 24 X uS8 9986
423 6P4H 25 X uS8 9986
424 6OUO 40 m 30S ribosomal protein S8 562
425 6RM3 69 SW0 uS8 6039
426 6OSQ 41 m 30S ribosomal protein S8 562
427 6OST 38 m 30S ribosomal protein S8 562
428 6OT3 40 m 30S ribosomal protein S8 562
429 6OSK 40 m 30S ribosomal protein S8 562
430 6ORE 42 m 30S ribosomal protein S8 562
431 6ORL 38 m 30S ribosomal protein S8 562
432 6OM7 29 SW 40S ribosomal protein S15a 9606
433 6OLZ 69 BW 40S ribosomal protein S15a 9606
434 6OM0 29 SW 40S ribosomal protein S15a 9606
435 6OLE 29 SW 40S ribosomal protein S15a 9606
436 6OLF 29 SW 40S ribosomal protein S15a 9606
437 6OLG 72 BW 40S ribosomal protein S15a 9606
438 6OLI 29 SW 40S ribosomal protein S15a 9606
439 6OKK 11 K 40S ribosomal protein S15A 5833
440 6RBD 15 W 40S ribosomal protein S22-A 4932
441 6RBE 15 W 40S ribosomal protein S22-A 4932
442 6OGF 35 M 30S ribosomal protein S8 562
443 6OGG 35 M 30S ribosomal protein S8 562
444 6OGI 35 M 30S ribosomal protein S8 562
445 6OFX 35 M 30S ribosomal protein S8 562
446 6OG7 35 M 30S ribosomal protein S8 562
447 6R7Q 82 TT Ribosomal protein S15a 9986
448 6R6G 50 TT Ribosomal protein S15a 9986
449 6R6P 66 TT Ribosomal protein S15a 9986
450 6R5Q 74 TT Ribosomal protein S15a 9986
451 6O9J 38 h 30S ribosomal protein S8 562
452 6O9K 8 h 30S ribosomal protein S8 562
453 6QZP 76 SW 40S ribosomal protein S15a 9606
454 6O7K 22 p 30S ribosomal protein S8 562
455 6NQB 9 H 30S ribosomal protein S8 562
456 6Q95 8 m 30S ribosomal protein S8 274
457 6Q97 45 m 30S ribosomal protein S8 562
458 6Q98 43 m 30S ribosomal protein S8 562
459 6Q9A 43 m 30S ribosomal protein S8 562
460 6Q8Y 27 b 40S ribosomal protein S22-A 4932
461 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
462 6IP5 75 3M 40S ribosomal protein S15a 9606
463 6IP6 74 3M 40S ribosomal protein S15a 9606
464 6IP8 74 3M 40S ribosomal protein S15a 9606
465 6MTB 73 WW 40S ribosomal protein S15a 9986
466 6MTC 72 WW 40S ribosomal protein S15a 9986
467 6MTD 74 WW uS8 9986
468 6MTE 73 WW uS8 9986
469 6HTQ 37 h 30S ribosomal protein S8 1423
470 6HRM 40 m 30S ribosomal protein S8 562
471 6HCQ 27 X2 Ribosomal protein S15a 9986
472 6HCJ 27 X2 Ribosomal protein S15a 9986
473 6HCM 24 X1 Ribosomal protein S15a 9986
474 6HCF 24 X1 Ribosomal protein S15a 9986
475 6HA1 38 h 30S ribosomal protein S8 1423
476 6HA8 40 h 30S ribosomal protein S8 1423
477 6H58 39 h, hh 30S ribosomal protein S8 562
478 6H4N 8 h 30S ribosomal protein S8 562
479 6DZI 8 q 30S ribosomal protein S8 1772
480 6DZK 8 H 30S ribosomal protein S8 1772
481 6GZX 38 H3, H4 30S ribosomal protein S8 274
482 6GZZ 38 H3, H4 30S ribosomal protein S8 274
483 6GZQ 38 H2 30S ribosomal protein S8 274
484 6GZ3 33 BW Ribosomal protein S15a 9986
485 6GZ4 36 BW ribosomal protein uS8 9986
486 6GZ5 33 BW ribosomal protein uS8 9986
487 6GXM 41 h 30S ribosomal protein S8 562
488 6GXN 41 h 30S ribosomal protein S8 562
489 6GXO 41 h 30S ribosomal protein S8 562
490 6GXP 40 h 30S ribosomal protein S8 562
491 6GWT 41 h 30S ribosomal protein S8 562
492 6GSL 8 72, 7E 30S ribosomal protein S8 274
493 6GSM 26 W 40S ribosomal protein S22 28985
494 6GSN 40 W 40S ribosomal protein S22 28985
495 6GQV 70 AM 40S ribosomal protein S22-A 4932
496 6GQ1 70 AM 40S ribosomal protein S22-A 4932
497 6GQB 70 AM 40S ribosomal protein S22-A 4932
498 6DNC 45 UA 30S ribosomal protein S8 562
499 6D9J 72 XX uS8 9986
500 6D90 73 XX uS8 9986
501 5ZLU 15 N 30S ribosomal protein S8 274
502 6G5H 14 W 40S ribosomal protein S15a 9606
503 6G5I 24 W 40S ribosomal protein S15a 9606
504 6G4S 19 W 40S ribosomal protein S15a 9606
505 6G4W 16 W 40S ribosomal protein S15a 9606
506 6G51 15 W 40S ribosomal protein S15a 9606
507 6G53 15 W 40S ribosomal protein S15a 9606
508 6G18 25 W 40S ribosomal protein S15a 9606
509 6FYX 26 W 40S ribosomal protein S22 28985
510 6FYY 26 W 40S ribosomal protein S22 28985
511 6FXC 8 Ah, Bh 30S ribosomal protein S8 1280
512 5ZEU 5 h 30S ribosomal protein S8 1772
513 5ZEB 5 h 30S ribosomal protein S8 1772
514 5ZEP 5 h 30S ribosomal protein S8 1772
515 6C4I 41 h 30S ribosomal protein S8 562
516 6FEC 29 a 40S ribosomal protein S15a 9606
517 6FAI 33 W 40S ribosomal protein S22-A 4932
518 6BU8 38 H 30S ribosomal protein S8 562
519 6BOH 42 RA, WC 30S ribosomal protein S8 274
520 6BOK 41 PA, SC 30S ribosomal protein S8 274
521 6ERI 41 BH 30S ribosomal protein S8, chloroplastic 3562
522 6ENU 8 h 30S ribosomal protein S8 562
523 6ENJ 38 h 30S ribosomal protein S8 562
524 6ENF 8 h 30S ribosomal protein S8 562
525 6EML 24 b 40S ribosomal protein S22-A 4932
526 6B4V 42 QA, UC 30S ribosomal protein S8 274
527 6EK0 76 SW 40S ribosomal protein S15a 9606
528 6AZ1 10 J ribosomal protein S8 5661
529 6AWB 13 K 30S ribosomal protein S8 562
530 6AWC 13 K 30S ribosomal protein S8 562
531 6AWD 12 K 30S ribosomal protein S8 562
532 5OT7 14 G 30S ribosomal protein S8 274
533 5OQL 45 w 40S ribosomal protein S22-like protein 209285
534 5OPT 22 e 40S ribosomal protein S15a, putative 5693
535 5WLC 13 LE rpS22_uS8 4932
536 5WFK 41 h 30S ribosomal protein S8 562
537 5WFS 41 h 30S ribosomal protein S8 562
538 5WF0 41 h 30S ribosomal protein S8 562
539 5XYU 7 H 30S ribosomal protein S8 1772
540 5XYI 24 W Ribosomal protein S15a 5722
541 5WE4 41 h 30S ribosomal protein S8 562
542 5WE6 41 h 30S ribosomal protein S8 562
543 5WDT 41 h 30S ribosomal protein S8 562
544 5XXU 24 W Ribosomal protein uS8 5811
545 5OA3 27 W 40S ribosomal protein S15a 9606
546 5O61 42 BH 30S ribosomal protein S8 1772
547 5O5J 8 H 30S ribosomal protein S8 1772
548 5O2R 42 h 30S ribosomal protein S8 562
549 5NWY 42 7 30S ribosomal protein S8 562
550 5VPP 37 QH, XH 30S ribosomal protein S8 274
551 5NP6 11 K 30S ribosomal protein S8 562
552 5NO2 6 H 30S ribosomal protein S8 562
553 5NO3 7 H 30S ribosomal protein S8 562
554 5NO4 7 H 30S ribosomal protein S8 562
555 5NJT 8 H 30S ribosomal protein S8 1423
556 5V93 39 h 30S ribosomal protein S8 1773
557 5NGM 8 Ah 30S ribosomal protein S8 1280
558 5ND8 8 h 30S ribosomal protein S8 1280
559 5ND9 8 h 30S ribosomal protein S8 1280
560 5X8P 38 h 30S ribosomal protein S8, chloroplastic 3562
561 5X8R 6 h 30S ribosomal protein S8, chloroplastic 3562
562 5UYK 38 H 30S ribosomal protein S8 562
563 5UYL 38 H 30S ribosomal protein S8 562
564 5UYM 38 H 30S ribosomal protein S8 562
565 5UYN 38 H 30S ribosomal protein S8 562
566 5UYP 38 H 30S ribosomal protein S8 562
567 5UYQ 38 H 30S ribosomal protein S8 562
568 5UZ4 7 H 30S ribosomal protein S8 562
569 5UQ7 39 h 30S ribosomal protein S8 274
570 5UQ8 39 h 30S ribosomal protein S8 274
571 5MYJ 8 AH 30S ribosomal protein S8 1358
572 5MY1 7 H 30S ribosomal protein S8 562
573 5WYJ 47 SX 40S ribosomal protein S22-A 4932
574 5WYK 43 SX 40S ribosomal protein S22-A 4932
575 5U9F 46 H 30S ribosomal protein S8 562
576 5U9G 46 H 30S ribosomal protein S8 562
577 5MMM 44 h 30S ribosomal protein S8, chloroplastic 3562
578 5MMJ 10 h 30S ribosomal protein S8, chloroplastic 3562
579 5U4I 39 h 30S ribosomal protein S8 Gene Name(s): rpsH b3306 JW3268 562
580 5TZS 14 E rpS22_uS8 4932
581 5MGP 39 h 30S ribosomal protein S8 562
582 5ME0 8 H 30S ribosomal protein S8 Taken from PDB entry 4YBB 562
583 5ME1 8 H 30S ribosomal protein S8 Taken from PDB entry 4YBB 562
584 5MDV 45 m 30S ribosomal protein S8 562
585 5MDW 45 m 30S ribosomal protein S8 562
586 5MDY 45 m 30S ribosomal protein S8 562
587 5MDZ 43 m 30S ribosomal protein S8 562
588 5H5U 46 o 30S ribosomal protein S8 562
589 5MC6 29 b 40S ribosomal protein S22-A 4932
590 5M1J 30 W2 40S ribosomal protein S22-A 4932
591 5LZS 73 WW uS8 9986
592 5LZT 74 WW uS8 9986
593 5LZU 73 WW uS8 9986
594 5LZV 74 WW uS8 9986
595 5LZW 74 WW uS8 9986
596 5LZX 74 WW uS8 9986
597 5LZY 72 WW uS8 9986
598 5LZZ 74 WW uS8 9986
599 5LZA 8 h 30S ribosomal protein S8 562
600 5LZB 8 h