3J9Y

Cryo-EM structure of tetracycline resistance protein TetM bound to a translating E.coli ribosome


Sequence Similarity Clusters for the Entities in PDB 3J9Y

Entity #1 | Chains: a
16S ribosomal RNA rna, length: 1539 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: p
30S ribosomal protein S16 protein, length: 82 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 171 212 150
95 % 171 212 191
90 % 171 212 203
70 % 171 212 221
50 % 175 216 224
40 % 175 216 234
30 % 175 216 246
Entity #11 | Chains: q
30S ribosomal protein S17 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 170 211 142
95 % 170 211 181
90 % 170 211 192
70 % 174 215 213
50 % 174 215 222
40 % 174 215 232
30 % 174 215 244
Entity #12 | Chains: r
30S ribosomal protein S18 protein, length: 75 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 136 156 210
95 % 138 160 268
90 % 138 160 279
70 % 144 166 310
50 % 144 166 364
40 % 144 166 379
30 % 144 166 396
Entity #13 | Chains: t
30S ribosomal protein S20 protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 170 210 144
95 % 170 210 188
90 % 170 210 199
70 % 170 210 220
50 % 178 218 215
40 % 178 218 226
30 % 201 242 218
Entity #14 | Chains: u
30S ribosomal protein S21 protein, length: 71 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 137 155 214
95 % 137 155 273
90 % 137 155 288
70 % 142 160 315
50 % 142 160 369
40 % 142 160 387
30 % 142 160 402
Entity #15 | Chains: v
P-site fMet-tRNAfMet rna, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #16 | Chains: x
mRNA rna, length: 11 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #17 | Chains: w
Tetracycline resistance protein TetM protein, length: 639 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 56768
95 % 2 3 28897
90 % 2 3 29451
70 % 2 4 22180
50 % 2 4 19548
40 % 2 4 16441
30 % 2 4 16144
Entity #18 | Chains: c
30S ribosomal protein S3 protein, length: 233 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 65 85 426
95 % 66 86 539
90 % 66 86 559
70 % 66 86 586
50 % 346 373 87
40 % 346 373 104
30 % 346 373 104
Entity #19 | Chains: g
30S ribosomal protein S7 protein, length: 179 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 54 74 471
95 % 169 208 196
90 % 169 208 211
70 % 54 74 685
50 % 54 74 720
40 % 54 74 754
30 % 54 74 788
Entity #2 | Chains: b
30S ribosomal protein S2 protein, length: 240 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 168 207 153
95 % 168 207 193
90 % 168 207 207
70 % 176 215 215
50 % 525 575 29
40 % 530 581 34
30 % 530 581 39
Entity #20 | Chains: i
30S ribosomal protein S9 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 169 210 148
95 % 169 210 187
90 % 169 210 198
70 % 177 218 212
50 % 521 572 30
40 % 521 572 37
30 % 521 572 42
Entity #21 | Chains: j
30S ribosomal protein S10 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 173 213 140
95 % 174 214 177
90 % 178 218 184
70 % 182 222 203
50 % 534 583 25
40 % 534 583 32
30 % 570 621 31
Entity #22 | Chains: m
30S ribosomal protein S13 protein, length: 118 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 172 214 143
95 % 172 214 183
90 % 172 214 195
70 % 180 222 208
50 % 530 583 26
40 % 533 586 33
30 % 533 586 38
Entity #23 | Chains: n
30S ribosomal protein S14 protein, length: 102 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 26 27 2106
95 % 169 207 192
90 % 169 207 206
70 % 169 207 223
50 % 179 217 220
40 % 184 223 222
30 % 185 224 230
Entity #24 | Chains: s
30S ribosomal protein S19 protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 170 210 145
95 % 170 210 189
90 % 170 210 201
70 % 178 218 210
50 % 532 584 24
40 % 532 584 31
30 % 532 584 37
Entity #25 | Chains: A
23S ribosomal RNA rna, length: 2903 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #26 | Chains: B
5S ribosomal RNA rna, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #27 | Chains: C
50S ribosomal protein L2 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 189 233 113
95 % 189 233 153
90 % 189 233 162
70 % 197 241 176
50 % 475 526 37
40 % 475 526 45
30 % 476 527 49
Entity #28 | Chains: D
50S ribosomal protein L3 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 198 245 109
95 % 198 245 148
90 % 198 245 157
70 % 206 253 170
50 % 479 532 36
40 % 483 536 41
30 % 483 537 45
Entity #29 | Chains: E
50S ribosomal protein L4 protein, length: 201 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 190 236 112
95 % 190 236 151
90 % 190 236 160
70 % 194 240 177
50 % 198 244 195
40 % 233 282 182
30 % 466 518 54
Entity #3 | Chains: d
30S ribosomal protein S4 protein, length: 206 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 170 210 147
95 % 171 211 182
90 % 171 211 194
70 % 179 219 207
50 % 510 559 32
40 % 538 589 30
30 % 538 589 35
Entity #30 | Chains: F
50S ribosomal protein L5 protein, length: 179 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 181 230 123
95 % 181 230 161
90 % 181 230 170
70 % 181 230 194
50 % 452 506 44
40 % 452 506 55
30 % 452 506 61
Entity #31 | Chains: G
50S ribosomal protein L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 179 225 128
95 % 179 225 167
90 % 179 225 176
70 % 179 225 197
50 % 187 233 206
40 % 456 513 49
30 % 459 517 52
Entity #32 | Chains: H
50S ribosomal protein L9 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 162 205 160
95 % 163 206 204
90 % 163 206 218
70 % 163 206 232
50 % 168 211 231
40 % 347 393 99
30 % 360 406 96
Entity #33 | Chains: I
50S ribosomal protein L11 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 145 195 162
95 % 145 195 212
90 % 145 195 228
70 % 149 199 235
50 % 218 295 147
40 % 220 299 160
30 % 220 300 167
Entity #34 | Chains: J
50S ribosomal protein L13 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 190 237 110
95 % 190 237 150
90 % 190 237 159
70 % 198 245 171
50 % 242 292 166
40 % 446 499 57
30 % 446 499 63
Entity #35 | Chains: K
50S ribosomal protein L14 protein, length: 123 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 228 122
95 % 180 228 160
90 % 180 228 169
70 % 188 236 181
50 % 470 529 34
40 % 470 529 42
30 % 470 529 46
Entity #36 | Chains: L
50S ribosomal protein L15 protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 189 236 111
95 % 190 237 149
90 % 190 237 158
70 % 190 237 180
50 % 198 245 192
40 % 468 521 46
30 % 468 521 51
Entity #37 | Chains: M
50S ribosomal protein L16 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 162 208 157
95 % 175 221 173
90 % 175 221 182
70 % 183 229 191
50 % 460 512 41
40 % 460 512 51
30 % 460 512 57
Entity #38 | Chains: N
50S ribosomal protein L17 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 174 220 136
95 % 180 226 166
90 % 180 226 173
70 % 188 234 185
50 % 420 469 56
40 % 461 513 47
30 % 461 515 50
Entity #39 | Chains: O
50S ribosomal protein L18 protein, length: 117 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 178 224 129
95 % 178 224 170
90 % 178 224 178
70 % 178 224 201
50 % 445 496 52
40 % 429 477 72
30 % 429 477 76
Entity #4 | Chains: e
30S ribosomal protein S5 protein, length: 167 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 171 199 158
95 % 171 212 180
90 % 171 212 191
70 % 179 220 206
50 % 526 579 27
40 % 526 579 35
30 % 526 579 40
Entity #40 | Chains: P
50S ribosomal protein L19 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 226 126
95 % 180 226 164
90 % 180 226 174
70 % 180 226 196
50 % 237 286 168
40 % 237 286 178
30 % 237 286 186
Entity #41 | Chains: Q
50S ribosomal protein L20 protein, length: 118 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 227 124
95 % 180 227 162
90 % 180 227 171
70 % 188 235 183
50 % 463 516 39
40 % 470 524 44
30 % 470 524 48
Entity #42 | Chains: R
50S ribosomal protein L21 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 223 132
95 % 180 223 171
90 % 180 223 180
70 % 180 223 202
50 % 188 231 207
40 % 462 511 52
30 % 462 511 58
Entity #43 | Chains: S
50S ribosomal protein L22 protein, length: 110 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 226 127
95 % 180 226 165
90 % 180 226 175
70 % 188 234 184
50 % 431 485 54
40 % 431 485 70
30 % 431 485 73
Entity #44 | Chains: T
50S ribosomal protein L23 protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 230 120
95 % 180 230 158
90 % 180 230 167
70 % 180 230 190
50 % 184 234 204
40 % 456 513 50
30 % 456 513 56
Entity #45 | Chains: U
50S ribosomal protein L24 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 229 121
95 % 180 229 159
90 % 180 229 168
70 % 180 229 193
50 % 434 489 49
40 % 434 489 68
30 % 434 491 70
Entity #46 | Chains: V
50S ribosomal protein L25 protein, length: 94 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 179 230 119
95 % 179 230 157
90 % 179 230 166
70 % 179 230 189
50 % 180 231 202
40 % 184 235 211
30 % 184 235 220
Entity #47 | Chains: W
50S ribosomal protein L27 protein, length: 85 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 179 225 131
95 % 180 226 168
90 % 180 226 177
70 % 213 259 159
50 % 463 513 40
40 % 463 513 48
30 % 463 513 55
Entity #48 | Chains: X
50S ribosomal protein L28 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 174 210 152
95 % 174 210 194
90 % 174 210 208
70 % 182 218 214
50 % 184 220 219
40 % 184 220 230
30 % 184 220 239
Entity #49 | Chains: Y
50S ribosomal protein L29 protein, length: 63 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 230 118
95 % 180 230 156
90 % 180 230 165
70 % 180 230 188
50 % 188 238 201
40 % 384 437 79
30 % 410 463 78
Entity #5 | Chains: f
30S ribosomal protein S6 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 64 84 429
95 % 66 86 535
90 % 66 86 563
70 % 66 86 590
50 % 70 90 592
40 % 70 90 640
30 % 70 90 657
Entity #50 | Chains: Z
50S ribosomal protein L30 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 227 125
95 % 180 227 163
90 % 180 227 172
70 % 180 227 195
50 % 245 294 164
40 % 452 506 56
30 % 452 506 62
Entity #51 | Chains: 0
50S ribosomal protein L32 protein, length: 57 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 224 130
95 % 180 224 169
90 % 180 224 179
70 % 180 224 198
50 % 184 228 209
40 % 184 228 218
30 % 449 499 65
Entity #52 | Chains: 1
50S ribosomal protein L33 protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 175 221 134
95 % 175 221 174
90 % 175 221 183
70 % 183 229 192
50 % 205 251 186
40 % 419 469 73
30 % 419 469 79
Entity #53 | Chains: 2
50S ribosomal protein L34 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 180 222 133
95 % 180 222 172
90 % 180 222 181
70 % 217 259 157
50 % 462 510 42
40 % 462 510 53
30 % 462 510 59
Entity #54 | Chains: 3
50S ribosomal protein L35 protein, length: 65 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 177 219 137
95 % 177 219 175
90 % 177 219 185
70 % 177 219 209
50 % 211 254 187
40 % 212 255 199
30 % 212 255 211
Entity #55 | Chains: 4
50S ribosomal protein L36 protein, length: 38 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 173 217 139
95 % 173 217 176
90 % 173 217 187
70 % 181 225 199
50 % 399 449 72
40 % 399 449 90
30 % 399 449 92
Entity #56 | Chains: 5
50S ribosomal protein L10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 29 41 1217
95 % 35 47 1400
90 % 35 47 1464
70 % 35 47 1491
50 % 35 47 1532
40 % 35 47 1562
30 % 64 77 877
Entity #57 | Chains: 6
50S ribosomal protein L31 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 66 84 539
95 % 66 84 722
90 % 66 84 754
70 % 66 84 777
50 % 66 84 809
40 % 268 289 130
30 % 269 290 141
Entity #58 | Chains: 7
50S ribosomal protein L7/L12 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 23174
95 % 2 4 20713
90 % 2 4 21737
70 % 2 4 18690
50 % 2 4 20259
40 % 2 4 16393
30 % 2 4 14825
Entity #6 | Chains: h
30S ribosomal protein S8 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 171 212 141
95 % 171 212 179
90 % 171 212 189
70 % 171 212 218
50 % 179 220 214
40 % 540 594 28
30 % 724 809 22
Entity #7 | Chains: k
30S ribosomal protein S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 169 210 149
95 % 169 210 185
90 % 169 210 200
70 % 173 214 216
50 % 525 577 28
40 % 525 577 36
30 % 525 577 41
Entity #8 | Chains: l
30S ribosomal protein S12 protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 139 184 171
95 % 167 212 184
90 % 167 212 196
70 % 519 581 16
50 % 537 600 21
40 % 537 600 27
30 % 537 600 33
Entity #9 | Chains: o
30S ribosomal protein S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 156 180 172
95 % 171 213 178
90 % 171 213 190
70 % 171 213 217
50 % 539 595 23
40 % 539 595 29
30 % 539 595 34

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1SEI 1 A, B RIBOSOMAL PROTEIN S8 1422
2 4YBB 8 AH, BH 30S ribosomal protein S8 562
3 4Y4O 39 1h, 2h 30S ribosomal protein S8 274
4 5J8B 41 h 30S ribosomal protein S8 274
5 1AN7 1 A, B RIBOSOMAL PROTEIN S8 274
6 4W2F 8 AH, CH 30S Ribosomal Protein S8 274
7 6CFL 39 1h, 2h 30S Ribosomal Protein S8 274
8 6CAE 39 1h, 2h 30S ribosomal protein S8 274
9 4Y4P 39 1h, 2h 30S ribosomal protein S8 274
10 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
11 5FDV 40 1h, 2h 30S ribosomal protein S8 274
12 5J4B 39 1h, 2h 30S ribosomal protein S8 274
13 4W2G 8 AH, CH 30S Ribosomal Protein S8 274
14 6CFK 39 1h, 2h 30S ribosomal protein S8 274
15 5J7L 8 AH, BH 30S ribosomal protein S8 562
16 5W4K 39 1h, 2h 30S ribosomal protein S8 274
17 4LFB 8 H ribosomal protein S8 274
18 1VY4 8 AH, CH 30S ribosomal protein S8 274
19 4WOI 8 AH, DH 30S ribosomal protein S8 562
20 5FDU 39 1h, 2h 30S ribosomal protein S8 274
21 6I7V 12 AH, BH 30S ribosomal protein S8 562
22 4W2I 8 AH, CH 30S Ribosomal Protein S8 274
23 5JC9 8 AH, BH 30S ribosomal protein S8 562
24 1VY5 8 AH, CH 30S ribosomal protein S8 274
25 5HCQ 39 1h, 2h 30S ribosomal protein S8 274
26 4WQF 41 BH, DH 30S ribosomal protein S8 274
27 6ND5 39 1h, 2h 30S ribosomal protein S8 274
28 4W2H 8 AH, CH 30S Ribosomal Protein S8 274
29 4WPO 41 BH, DH 30S ribosomal protein S8 274
30 5J8A 8 AH, BH 30S ribosomal protein S8 562
31 4V8I 8 AH, CH 30S Ribosomal Protein S8 274
32 4JI1 8 H RIBOSOMAL PROTEIN S8 274
33 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
34 4Z3S 39 1h, 2h 30S ribosomal protein S8 274
35 5DOY 39 1h, 2h 30S Ribosomal Protein S8 274
36 5J5B 8 AH, BH 30S ribosomal protein S8 562
37 5HD1 39 1h, 2h 30S ribosomal protein S8 274
38 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
39 4DR6 8 H 30S ribosomal protein S8 274
40 4LF7 8 H ribosomal protein S8 274
41 4LF8 8 H ribosomal protein S8 274
42 5WIS 39 1h, 2h 30S ribosomal protein S8 274
43 4WSD 8 72, 7E 30S ribosomal protein S8 274
44 4WQU 41 BH, DH 30S ribosomal protein S8 274
45 5WIT 39 1h, 2h 30S ribosomal protein S8 274
46 5E81 8 72, 7E 30S ribosomal protein S8 274
47 2VQE 8 H 30S RIBOSOMAL PROTEIN S8 274
48 6GSJ 8 72, 7E 30S ribosomal protein S8 274
49 4U27 8 AH, CH 30S ribosomal protein S8 562
50 6OF1 39 1h, 2h 30S ribosomal protein S8 274
51 6CFJ 39 1h, 2h 30S ribosomal protein S8 274
52 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
53 4Z8C 39 1h, 2h 30S ribosomal protein S8 274
54 5HCR 39 1h, 2h 30S ribosomal protein S8 274
55 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
56 2UUB 8 H 30S RIBOSOMAL PROTEIN S8 274
57 4DV6 8 H ribosomal protein S8 274
58 4JYA 8 H 30S ribosomal protein S8 274
59 5IBB 8 72, 7E 30S ribosomal protein S8 274
60 4DR5 8 H 30S ribosomal protein S8 274
61 5J4C 39 1h, 2h 30S ribosomal protein S8 274
62 4KHP 8 H 30S Ribosomal protein S8 274
63 4DR2 8 H 30S ribosomal protein S8 274
64 4WRO 12 7E 30S ribosomal protein S8 274
65 4WQ1 8 72, 7E 30S ribosomal protein S8 274
66 4LF9 8 H ribosomal protein S8 274
67 4WQY 41 BH, DH 30S ribosomal protein S8 274
68 4DUY 8 H ribosomal protein S8 274
69 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
70 4DV7 8 H ribosomal protein S8 274
71 4WRA 8 72, 7E 30S ribosomal protein S8 274
72 1S03 2 G, H 30S ribosomal protein S8 562
73 5IB7 8 72, 7E 30S ribosomal protein S8 274
74 4U26 8 AH, CH 30S ribosomal protein S8 562
75 4X64 8 H 30S ribosomal protein S8 274
76 5HCP 39 1h, 2h 30S ribosomal protein S8 274
77 5IT8 8 AH, BH 30S ribosomal protein S8 562
78 4V9D 8 AH, BH 30S ribosomal protein S8 562
79 4V9P 40 BH, DH, FH, HH 30S ribosomal protein S8 562
80 4V9H 21 AH 30S ribosomal protein S8 274
81 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
82 5J91 8 AH, BH 30S ribosomal protein S8 562
83 4V8D 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
84 5WNT 8 H RIBOSOMAL PROTEIN S8 274
85 4DR3 8 H 30S ribosomal protein S8 274
86 4V90 8 AH 30S RIBOSOMAL PROTEIN S8 274
87 4JI3 8 H RIBOSOMAL PROTEIN S8 274
88 4WQR 8 72, 7E 30S ribosomal protein S8 274
89 4JI6 8 H RIBOSOMAL PROTEIN S8 274
90 4JI8 8 H RIBOSOMAL PROTEIN S8 274
91 2UXC 8 H RIBOSOMAL PROTEIN S8 274
92 5IB8 8 72, 7E 30S ribosomal protein S8 274
93 4V9R 8 AH, CH 30S Ribosomal Protein S8 274
94 4B3M 8 H 30S RIBOSOMAL PROTEIN S8 274
95 5EL6 8 72, 7E 30S ribosomal protein S8 274
96 6O97 39 1h, 2h 30S ribosomal protein S8 274
97 5EL7 8 72, 7E 30S ribosomal protein S8 274
98 5VP2 39 1h, 2h 30S ribosomal protein S8 274
99 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
100 4LF4 8 H ribosomal protein S8 274
101 5DFE 42 QH, XH 30S ribosomal protein S8 274
102 5NDK 50 72, 7E 30S ribosomal protein S8 274
103 4LF6 8 H ribosomal protein S8 274
104 4JI7 8 H RIBOSOMAL PROTEIN S8 274
105 5J88 8 AH, BH 30S ribosomal protein S8 562
106 4U24 8 AH, CH 30S ribosomal protein S8 562
107 4WU1 8 72, 7E 30S ribosomal protein S8 274
108 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
109 6QNR 8 72, 7E 30S ribosomal protein S8 274
110 5EL4 8 72, 7E 30S ribosomal protein S8 274
111 5WNV 8 H 30S ribosomal protein S8 274
112 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
113 4B3T 8 H 30S RIBOSOMAL PROTEIN S8 274
114 4WR6 8 72, 7E 30S ribosomal protein S8 274
115 4V8B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
116 5HAU 41 1h, 2h 30S ribosomal protein S8 274
117 4V9O 41 BH, DH, FH, HH 30S ribosomal protein S8 562
118 6MPF 8 H 30S ribosomal protein S8 274
119 2VQF 8 H 30S RIBOSOMAL PROTEIN S8 274
120 2UUA 8 H 30S RIBOSOMAL PROTEIN S8 274
121 4V87 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
122 4WF1 8 AH, CH 30S ribosomal protein S8 562
123 4U25 8 AH, CH 30S ribosomal protein S8 562
124 4V95 8 AH, CH 30S Ribosomal Protein S8 274
125 4WWW 39 QH, XH 30S ribosomal protein S8 562
126 4V7T 8 AH, CH 30S ribosomal protein S8 562
127 1VY7 8 AH, CH 30S ribosomal protein S8 274
128 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
129 5E7K 8 72, 7E 30S ribosomal protein S8 274
130 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
131 5EL5 8 72, 7E 30S ribosomal protein S8 274
132 6FKR 39 1h, 2h 30S ribosomal protein S8 274
133 4B3R 8 H 30S RIBOSOMAL PROTEIN S8 274
134 4LNT 8 QH, XH 30S ribosomal protein S8 274
135 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
136 4DR1 8 H 30S ribosomal protein S8 274
137 4LFA 8 H ribosomal protein S8 274
138 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
139 4DV4 8 H ribosomal protein S8 274
140 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
141 4YZV 8 QH, XH 30S ribosomal protein S8 274
142 4JI0 8 H ribosomal protein S8 274
143 5IWA 7 H 30S ribosomal protein S8 274
144 4V7U 8 AH, CH 30S ribosomal protein S8 562
145 4V9S 8 AH, CH 30S Ribosomal Protein S8 274
146 4JI2 8 H RIBOSOMAL PROTEIN S8 274
147 4V6C 7 AH, CH 30S ribosomal protein S8 562
148 4JV5 8 H 30S ribosomal protein S8 274
149 4DR7 8 H 30S ribosomal protein S8 274
150 1J5E 8 H 30S RIBOSOMAL PROTEIN S8 274
151 6OF6 8 QH, XH 30S ribosomal protein S8 274
152 4GKK 8 H 30S ribosomal protein S8 274
153 4DUZ 8 H ribosomal protein S8 274
154 5NDJ 50 72, 7E 30S ribosomal protein S8 274
155 4V7V 8 AH, CH 30S ribosomal protein S8 562
156 4X65 8 H 30S ribosomal protein S8 274
157 4V8G 8 AH, CH 30S Ribosomal Protein S8 274
158 4GKJ 8 H 30S ribosomal protein S8 274
159 4DV3 8 H ribosomal protein S8 274
160 4V7S 8 AH, CH 30S ribosomal protein S8 562
161 4DV5 8 H ribosomal protein S8 274
162 5DAT 24 D2 40S ribosomal protein S22-A 4932
163 5DAT 80 d2 40S ribosomal protein S22-A 4932
164 6LKQ 7 G 30S ribosomal protein S8 562
165 2UUC 8 H 30S RIBOSOMAL PROTEIN S8 274
166 4LFC 8 H ribosomal protein S8 274
167 1FJG 9 H 30S RIBOSOMAL PROTEIN S8 274
168 3T1Y 8 H 30S ribosomal protein S8 274
169 4WZO 8 72, 7E 30S ribosomal protein S8 274
170 4JI4 8 H RIBOSOMAL PROTEIN S8 274
171 1VY6 8 AH, CH 30S ribosomal protein S8 274
172 1XMQ 10 H 30S Ribosomal Protein S8 274
173 5WNP 8 H 30S ribosomal protein S8 274
174 6CAP 8 H 30S ribosomal protein S8 274
175 4U20 8 AH, CH 30S ribosomal protein S8 562
176 6MPI 8 H 30S ribosomal protein S8 274
177 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
178 4DV0 8 H ribosomal protein S8 274
179 4V9B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
180 4U1V 8 AH, CH 30S ribosomal protein S8 562
181 4V6F 38 BK, CK 30S ribosomal protein S8 274
182 4X62 8 H 30S ribosomal protein S8 274
183 4V8F 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
184 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
185 4B3S 8 H 30S RIBOSOMAL PROTEIN S8 274
186 4DV2 8 H ribosomal protein S8 274
187 4DV1 8 H ribosomal protein S8 274
188 5WNU 8 H 30S ribosomal protein S8 274
189 1N32 10 H 30S RIBOSOMAL PROTEIN S8 274
190 5F8K 39 1h, 2h 30S ribosomal protein S8 274
191 1I94 8 H 30S RIBOSOMAL PROTEIN S8 274
192 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
193 4V8H 8 AH, CH 30S Ribosomal Protein S8 274
194 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
195 4JI5 8 H RIBOSOMAL PROTEIN S8 274
196 6CAQ 8 H 30S ribosomal protein S8 274
197 4K0K 8 H 30S ribosomal protein S8 274
198 4W2E 41 h 30S ribosomal protein S8 274
199 4V8C 38 CK, DK 30S RIBOSOMAL PROTEIN S8 274
200 5BR8 8 H 30S ribosomal protein S8 274
201 4LF5 8 H ribosomal protein S8 274
202 5J4D 42 QA, VC 30S ribosomal protein S8 274
203 4V9A 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
204 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
205 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
206 4V5J 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
207 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
208 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
209 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
210 6ND6 39 1h, 2h 30S ribosomal protein S8 274
211 4V7Y 8 AH, CH 30S ribosomal protein S8 274
212 6UO1 39 1h, 2h 30S ribosomal protein S8 274
213 6GSK 8 72, 7E 30S ribosomal protein S8 274
214 4V9C 8 AH, CH 30S ribosomal protein S8 562
215 4V8E 38 BK, DK 30S RIBOSOMAL PROTEIN S8 274
216 5J30 39 QH, XH 30S ribosomal protein S8 274
217 6QNQ 8 72, 7E 30S ribosomal protein S8 274
218 4DR4 8 H 30S ribosomal protein S8 274
219 4WZD 8 72, 7E 30S ribosomal protein S8 274
220 6OPE 8 QH, XH 30S ribosomal protein S8 274
221 3OTO 8 H 30S RIBOSOMAL PROTEIN S8 274
222 4X66 8 H 30S ribosomal protein S8 274
223 2UU9 8 H 30S RIBOSOMAL PROTEIN S8 274
224 4V8Q 42 BH 30S RIBOSOMAL PROTEIN S8 274
225 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
226 4V85 8 AH 30S ribosomal protein S8 562
227 1HR0 9 H 30S RIBOSOMAL PROTEIN S8 274
228 4AQY 8 H 30S RIBOSOMAL PROTEIN S8 274
229 4W4G 8 QH, XH 30S ribosomal protein S8 274
230 4NXM 8 H ribosomal protein S8 274
231 4V5L 8 AH 30S RIBOSOMAL PROTEIN S8 274
232 4YPB 8 QH, XH 30S ribosomal protein S8 274
233 4V7X 8 AH, CH 30S ribosomal protein S8 274
234 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
235 4U1U 8 AH, CH 30S ribosomal protein S8 562
236 4ZER 39 1h, 2h 30S ribosomal protein S8 274
237 1IBL 11 H 30S RIBOSOMAL PROTEIN S8 274
238 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
239 6ORD 8 QH, XH 30S ribosomal protein S8 274
240 4V7W 8 AH, CH 30S ribosomal protein S8 274
241 4WT1 8 72, 7E 30S ribosomal protein S8 274
242 6C5L 8 AH, CH 30S ribosomal protein S8 274
243 4WT8 8 AH, BH 30S ribosomal protein S8 274
244 5DOX 39 1h, 2h 30S ribosomal protein S8 274
245 6OTR 8 QH, XH 30S ribosomal protein S8 274
246 4NXN 8 H ribosomal protein S8 274
247 1XNR 10 H 16S Ribosomal protein S8 274
248 4LT8 8 QH, XH 30S ribosomal protein S8 274
249 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
250 5WNQ 8 H 30S ribosomal protein S8 274
251 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
252 6MKN 8 H 30S ribosomal protein S8 274
253 4V51 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
254 6DTI 8 H 30S ribosomal protein S8 274
255 4V7L 8 AH, CH 30S ribosomal protein S8 274
256 4V5R 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
257 1HNZ 9 H 30S RIBOSOMAL PROTEIN S8 274
258 1XNQ 10 H Ribosomal protein S8 274
259 4V8A 38 CH, DH 30S ribosomal protein S8 274
260 4V5K 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
261 4V5Q 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
262 4V7J 7 Ah, Bh 30S ribosomal protein S8 274
263 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
264 6BZ6 8 QH, XH 30S ribosomal protein S8 274
265 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
266 5J3C 39 QH, XH 30S ribosomal protein S8 274
267 4V5C 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
268 4V5E 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
269 4L47 8 QH, XH 30S ribosomal protein S8 274
270 4V5P 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
271 5V8I 39 1h, 2h 30S ribosomal protein S8 274
272 4ZSN 8 QH, XH 30S ribosomal protein S8 274
273 4V5D 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
274 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
275 6CZR 39 1h, 2h 30S ribosomal protein S8 274
276 6OXA 8 QH, XH 30S ribosomal protein S8 274
277 6BUW 8 QH, XH 30S ribosomal protein S8 274
278 4V7Z 8 AH, CH 30S ribosomal protein S8 274
279 4V8X 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
280 4V5S 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
281 4V9I 8 AH, CH 30S Ribosomal protein S8 274
282 1XMO 10 H 30S ribosomal protein S8 274
283 3T1H 8 H 30S ribosomal protein S8 274
284 2UXD 8 H RIBOSOMAL PROTEIN S8 274
285 6OJ2 8 QH, XH 30S ribosomal protein S8 274
286 1N33 10 H 30S RIBOSOMAL PROTEIN S8 274
287 1IBK 9 H 30S RIBOSOMAL PROTEIN S8 274
288 4V6G 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
289 4V8N 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
290 4V97 8 AH, CH 30S ribosomal protein S8 274
291 6CAR 8 H 30S ribosomal protein S8 274
292 1HNW 9 H 30S RIBOSOMAL PROTEIN S8 274
293 4V7M 8 AH, CH 30S ribosomal protein S8 274
294 4WSM 8 72, 7E 30S ribosomal protein S8 274
295 4TUD 8 QH, XH 30S ribosomal protein S8 274
296 1IBM 11 H 30S RIBOSOMAL PROTEIN S8 274
297 5WNR 8 H 30S ribosomal protein S8 274
298 6CAO 8 H 30S ribosomal protein S8 274
299 4V6A 8 AH, CH 30S ribosomal protein S8 274
300 4TUE 8 QH, XH 30S ribosomal protein S8 274
301 6OXI 8 QH, XH 30S ribosomal protein S8 274
302 4TUA 8 QH, XH 30S ribosomal protein S8 274
303 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
304 4V84 8 AH, CH 30S ribosomal protein S8 274
305 5WNS 8 H 30S ribosomal protein S8 274
306 6NDK 8 QH, XH 30S ribosomal protein S8 274
307 4V7K 7 Ah, Bh 30S ribosomal protein S8 274
308 4YY3 8 H 30S ribosomal protein S8 274
309 1HNX 9 H 30S RIBOSOMAL PROTEIN S8 274
310 4V9Q 38 BH, DH 30S ribosomal protein S8 274
311 6BZ8 8 QH, XH 30S ribosomal protein S8 274
312 4TUC 8 QH, XH 30S ribosomal protein S8 274
313 4YHH 8 H 30S ribosomal protein S8 274
314 5VPO 9 QH, XH 30S ribosomal protein S8 274
315 6NY6 8 H 30S ribosomal protein S8 274
316 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
317 4TUB 8 QH, XH 30S ribosomal protein S8 274
318 4V9N 11 AH, CH 30S ribosomal protein S8 274
319 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
320 4P70 8 QH, XH 30S ribosomal protein S8 274
321 4V8U 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
322 4LSK 8 QH, XH 30S ribosomal protein S8 274
323 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
324 4V6D 7 AH, CH 30S ribosomal protein S8 562
325 4P6F 8 QH, XH 30S ribosomal protein S8 274
326 4V67 10 AH, CH 30S ribosomal protein S8 274
327 4V83 8 AH, CH 30S ribosomal protein S8 274
328 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
329 4V5F 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
330 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
331 1VVJ 8 QH, XH 30S ribosomal protein S8 274
332 4LFZ 8 QH, XH 30S ribosomal protein S8 274
333 2E5L 9 H 30S ribosomal protein S8 274
334 6BZ7 8 QH, XH 30S ribosomal protein S8 274
335 6N1D 42 AS08, BS08 30S ribosomal protein S8 274
336 4V6E 7 AH, CH 30S ribosomal protein S8 562
337 6UCQ 38 1h, 2h 30S ribosomal protein S8 274
338 6CAS 8 H 30S ribosomal protein S8 274
339 4V52 7 AH, CH 30S ribosomal protein S8 562
340 5CZP 39 QH, XH 30S ribosomal protein S8 274
341 6N9F 39 1h, 2h 30S Ribosomal Protein S8 274
342 6N9E 39 1h, 2h 30S Ribosomal Protein S8 274
343 2HHH 8 H 30S ribosomal protein S8 274
344 4V89 8 AH 30S ribosomal protein S8 562
345 4OX9 8 H 30S ribosomal protein S8 274
346 4V54 7 AH, CH 30S ribosomal protein S8 562
347 2UXB 8 H RIBOSOMAL PROTEIN S8 274
348 1I96 8 H 30S RIBOSOMAL PROTEIN S8 274
349 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
350 4V9K 7 AH, CH 30S ribosomal protein S8 274
351 4V50 10 AH, CH 30S ribosomal protein S8 562
352 1N34 9 H 30S RIBOSOMAL PROTEIN S8 274
353 4V57 7 AH, CH 30S ribosomal protein S8 562
354 4V5A 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
355 4V63 10 AH, CH 30S ribosomal protein S8 274
356 4L71 8 QH, XH 30S ribosomal protein S8 274
357 4KVB 8 H 30S ribosomal protein S8 274
358 4XEJ 35 AS08, BS08 30S ribosomal protein S8 274
359 4V64 7 AH, CH 30S ribosomal protein S8 562
360 4V7P 8 AH, DH 30S ribosomal protein S8 274
361 4V8J 8 AH, CH 30S ribosomal protein S8 274
362 1N36 8 H 30S RIBOSOMAL PROTEIN S8 274
363 2ZM6 8 H 30S ribosomal protein S8 274
364 4V4H 7 AH, CH 30S RIBOSOMAL PROTEIN S8 562
365 4V4Q 7 AH, CH 30S ribosomal protein S8 562
366 4V5B 40 BH, DH 30S RIBOSOMAL PROTEIN S8 RESIDUES 2-130 562
367 5D8B 35 EC, IA 30S ribosomal protein S8 274
368 6BY1 43 AH, BH 30S ribosomal protein S8 562
369 4LEL 8 QH, XH 30S ribosomal protein S8 274
370 4V53 7 AH, CH 30S ribosomal protein S8 562
371 2F4V 9 H 30S ribosomal protein S8 274
372 4V9L 7 AH, CH 30S ribosomal protein S8 274
373 1FKA 8 H 30S RIBOSOMAL PROTEIN S8 274
374 4V5G 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
375 4V56 7 AH, CH 30S ribosomal protein S8 562
376 1I97 8 H 30S RIBOSOMAL PROTEIN S8 274
377 4V9J 7 AH, CH 30S ribosomal protein S8 274
378 4V55 7 AH, CH 30S ribosomal protein S8 562
379 1I95 8 H 30S RIBOSOMAL PROTEIN S8 274
380 4V8O 8 AH 30S RIBOSOMAL PROTEIN S8 274
381 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
382 4V9M 7 AH, CH 30S ribosomal protein S8 274
383 4W29 7 AH, CH 30S ribosomal protein S8 274
384 4V5Y 7 AH, CH 30S ribosomal protein S8 562
385 4V4Y 10 AK 30S ribosomal protein S8 274
386 4V4J 41 i 30S ribosomal protein S8 274
387 4V4X 10 AK 30S ribosomal protein S8 274
388 4V4Z 11 AK 30S ribosomal protein S8 274
389 4V4I 41 i 30S ribosomal protein S8 274
390 4V4P 43 BK 30S ribosomal protein S8 274
391 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
392 4V4R 11 AH 30S ribosomal protein S8 274
393 4V4S 11 AH 30S ribosomal protein S8 274
394 4V4T 11 AH 30S ribosomal protein S8 274
395 4KZZ 23 W 40S Ribosomal Protein S15A 9986
396 4KZX 23 W 40S ribosomal protein S15A 9986
397 4KZY 23 W 40S Ribosomal Protein S15A 9986
398 4V49 10 AH 30S ribosomal protein S8 562
399 4V4A 8 AH 30S ribosomal protein S8 562
400 4V4G 8 AH, CH, EH, GH, IH 30S ribosomal protein S8 562
401 6ZOJ 24 W 40S ribosomal protein S15a 9606
402 6WNV 36 M 30S ribosomal protein S8 562
403 6WNW 38 M 30S ribosomal protein S8 562
404 6WD0 37 M 30S ribosomal protein S8 562
405 6WD1 37 M 30S ribosomal protein S8 562
406 6WD2 37 M 30S ribosomal protein S8 562
407 6WD3 37 M 30S ribosomal protein S8 562
408 6WD4 37 M 30S ribosomal protein S8 562
409 6WD5 37 M 30S ribosomal protein S8 562
410 6WD6 37 M 30S ribosomal protein S8 562
411 6WD7 37 M 30S ribosomal protein S8 562
412 6WD8 37 M 30S ribosomal protein S8 562
413 6WD9 37 M 30S ribosomal protein S8 562
414 6WDA 37 M 30S ribosomal protein S8 562
415 6WDB 37 M 30S ribosomal protein S8 562
416 6WDC 37 M 30S ribosomal protein S8 562
417 6WDD 37 M 30S ribosomal protein S8 562
418 6WDE 37 M 30S ribosomal protein S8 562
419 6WDF 37 M 30S ribosomal protein S8 562
420 6WDG 37 M 30S ribosomal protein S8 562
421 6WDH 37 M 30S ribosomal protein S8 562
422 6WDI 37 M 30S ribosomal protein S8 562
423 6WDJ 37 M 30S ribosomal protein S8 562
424 6WDK 37 M 30S ribosomal protein S8 562
425 6WDL 37 M 30S ribosomal protein S8 562
426 6WDM 37 M 30S ribosomal protein S8 562
427 6YAL 23 Y 40S ribosomal protein uS8 9986
428 6YAM 23 Y 40S ribosomal protein uS8 9986
429 6YAN 22 Y Ribosomal protein S15a 9986
430 6W2S 15 X uS8 9986
431 6W2T 14 X uS8 9986
432 6Y7C 22 W 40S ribosomal protein S22-A 4932
433 6Y69 8 h 30S ribosomal protein S8 562
434 6Y57 71 SW 40S ribosomal protein S15a 9606
435 6VWL 38 g 30S ribosomal protein S8 562
436 6VWM 38 g 30S ribosomal protein S8 562
437 6VWN 38 g 30S ribosomal protein S8 562
438 6Y2L 71 SW 40S ribosomal protein S15a 9606
439 6Y0G 72 SW 40S ribosomal protein S15a 9606
440 6XYW 64 Bg 40S ribosomal protein S15a-5 3702
441 6TNU 26 b 40S ribosomal protein S22-A 4932
442 6TMF 10 J 30S ribosomal protein S8 2264
443 6V39 38 h 30S ribosomal protein S8 470
444 6V3A 38 h 30S ribosomal protein S8 470
445 6V3B 38 h 30S ribosomal protein S8 470
446 6V3E 8 h 30S ribosomal protein S8 470
447 6UZ7 70 W 40S ribosomal protein S22 28985
448 6TC3 8 S081 30S ribosomal protein S8 562
449 6TBV 8 S081 30S ribosomal protein S8 562
450 6TB3 26 b 40S ribosomal protein S22-A 4932
451 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
452 6T7T 26 SW 40S ribosomal protein S22-A 4932
453 6T7I 24 SW 40S ribosomal protein S22-A 4932
454 6T4Q 23 SW 40S ribosomal protein S22-A 4932
455 6SZS 39 h 30S ribosomal protein S8 562
456 6SW9 10 I 30S ribosomal protein S8 29292
457 6SWC 10 I 30S ribosomal protein S8 29292
458 6SWD 9 I 30S ribosomal protein S8 29292
459 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
460 6SPC 8 h 30S ribosomal protein S8 287
461 6SPE 8 h 30S ribosomal protein S8 287
462 6SPF 40 h 30S ribosomal protein S8 287
463 6SPG 8 h 30S ribosomal protein S8 287
464 6SNT 24 W 40S ribosomal protein S22-A 4932
465 6SGC 24 X1 Ribosomal protein S15a 9986
466 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
467 6S0X 38 h 30S ribosomal protein S8 1280
468 6S13 38 h 30S ribosomal protein S8 1280
469 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
470 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
471 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
472 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
473 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
474 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
475 6P5I 24 X uS8 9986
476 6P5J 24 X uS8 9986
477 6P5K 70 X uS8 9986
478 6P5N 70 X uS8 9986
479 6P4G 24 X uS8 9986
480 6P4H 25 X uS8 9986
481 6OUO 40 m 30S ribosomal protein S8 562
482 6RM3 69 SW0 uS8 6039
483 6OSQ 41 m 30S ribosomal protein S8 562
484 6OST 38 m 30S ribosomal protein S8 562
485 6OT3 40 m 30S ribosomal protein S8 562
486 6OSK 40 m 30S ribosomal protein S8 562
487 6ORE 42 m 30S ribosomal protein S8 562
488 6ORL 38 m 30S ribosomal protein S8 562
489 6OM7 29 SW 40S ribosomal protein S15a 9606
490 6OLZ 69 BW 40S ribosomal protein S15a 9606
491 6OM0 29 SW 40S ribosomal protein S15a 9606
492 6OLE 29 SW 40S ribosomal protein S15a 9606
493 6OLF 29 SW 40S ribosomal protein S15a 9606
494 6OLG 72 BW 40S ribosomal protein S15a 9606
495 6OLI 29 SW 40S ribosomal protein S15a 9606
496 6OKK 11 K 40S ribosomal protein S15A 5833
497 6RBD 15 W 40S ribosomal protein S22-A 4932
498 6RBE 15 W 40S ribosomal protein S22-A 4932
499 6OGF 35 M 30S ribosomal protein S8 562
500 6OGG 35 M 30S ribosomal protein S8 562
501 6OGI 35 M 30S ribosomal protein S8 562
502 6OFX 35 M 30S ribosomal protein S8 562
503 6OG7 35 M 30S ribosomal protein S8 562
504 6R7Q 82 TT Ribosomal protein S15a 9986
505 6R6G 50 TT Ribosomal protein S15a 9986
506 6R6P 66 TT Ribosomal protein S15a 9986
507 6R5Q 74 TT Ribosomal protein S15a 9986
508 6O9J 38 h 30S ribosomal protein S8 562
509 6O9K 8 h 30S ribosomal protein S8 562
510 6QZP 76 SW 40S ribosomal protein S15a 9606
511 6O7K 22 p 30S ribosomal protein S8 562
512 6NQB 9 H 30S ribosomal protein S8 562
513 6Q95 8 m 30S ribosomal protein S8 274
514 6Q97 45 m 30S ribosomal protein S8 562
515 6Q98 43 m 30S ribosomal protein S8 562
516 6Q9A 43 m 30S ribosomal protein S8 562
517 6Q8Y 27 b 40S ribosomal protein S22-A 4932
518 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
519 6IP5 75 3M 40S ribosomal protein S15a 9606
520 6IP6 74 3M 40S ribosomal protein S15a 9606
521 6IP8 74 3M 40S ribosomal protein S15a 9606
522 6MTB 73 WW 40S ribosomal protein S15a 9986
523 6MTC 72 WW 40S ribosomal protein S15a 9986
524 6MTD 74 WW uS8 9986
525 6MTE 73 WW uS8 9986
526 6HTQ 37 h 30S ribosomal protein S8 1423
527 6HRM 40 m 30S ribosomal protein S8 562
528 6HCQ 27 X2 Ribosomal protein S15a 9986
529 6HCJ 27 X2 Ribosomal protein S15a 9986
530 6HCM 24 X1 Ribosomal protein S15a 9986
531 6HCF 24 X1 Ribosomal protein S15a 9986
532 6HA1 38 h 30S ribosomal protein S8 1423
533 6HA8 40 h 30S ribosomal protein S8 1423
534 6H58 39 h, hh 30S ribosomal protein S8 562
535 6H4N 8 h 30S ribosomal protein S8 562
536 6DZI 8 q 30S ribosomal protein S8 1772
537 6DZK 8 H 30S ribosomal protein S8 1772
538 6GZX 38 H3, H4 30S ribosomal protein S8 274
539 6GZZ 38 H3, H4 30S ribosomal protein S8 274
540 6GZQ 38 H2 30S ribosomal protein S8 274
541 6GZ3 33 BW Ribosomal protein S15a 9986
542 6GZ4 36 BW ribosomal protein uS8 9986
543 6GZ5 33 BW ribosomal protein uS8 9986
544 6GXM 41 h 30S ribosomal protein S8 562
545 6GXN 41 h 30S ribosomal protein S8 562
546 6GXO 41 h 30S ribosomal protein S8 562
547 6GXP 40 h 30S ribosomal protein S8 562
548 6GWT 41 h 30S ribosomal protein S8 562
549 6GSL 8 72, 7E 30S ribosomal protein S8 274
550 6GSM 26 W 40S ribosomal protein S22 28985
551 6GSN 40 W 40S ribosomal protein S22 28985
552 6GQV 70 AM 40S ribosomal protein S22-A 4932
553 6GQ1 70 AM 40S ribosomal protein S22-A 4932
554 6GQB 70 AM 40S ribosomal protein S22-A 4932
555 6DNC 45 UA 30S ribosomal protein S8 562
556 6D9J 72 XX uS8 9986
557 6D90 73 XX uS8 9986
558 5ZLU 15 N 30S ribosomal protein S8 274
559 6G5H 14 W 40S ribosomal protein S15a 9606
560 6G5I 24 W 40S ribosomal protein S15a 9606
561 6G4S 19 W 40S ribosomal protein S15a 9606
562 6G4W 16 W 40S ribosomal protein S15a 9606
563 6G51 15 W 40S ribosomal protein S15a 9606
564 6G53 15 W 40S ribosomal protein S15a 9606
565 6G18 25 W 40S ribosomal protein S15a 9606
566 6FYX 26 W 40S ribosomal protein S22 28985
567 6FYY 26 W 40S ribosomal protein S22 28985
568 6FXC 8 Ah, Bh 30S ribosomal protein S8 1280
569 5ZEU 5 h 30S ribosomal protein S8 1772
570 5ZEB 5 h 30S ribosomal protein S8 1772
571 5ZEP 5 h 30S ribosomal protein S8 1772
572 6C4I 41 h 30S ribosomal protein S8 562
573 6FEC 29 a 40S ribosomal protein S15a 9606
574 6FAI 33 W 40S ribosomal protein S22-A 4932
575 6BU8 38 H 30S ribosomal protein S8 562
576 6BOH 42 RA, WC 30S ribosomal protein S8 274
577 6BOK 41 PA, SC 30S ribosomal protein S8 274
578 6ERI 41 BH 30S ribosomal protein S8, chloroplastic 3562
579 6ENU 8 h 30S ribosomal protein S8 562
580 6ENJ 38 h 30S ribosomal protein S8 562
581 6ENF 8 h 30S ribosomal protein S8 562
582 6EML 24 b 40S ribosomal protein S22-A 4932
583 6B4V 42 QA, UC 30S ribosomal protein S8 274
584 6EK0 76 SW 40S ribosomal protein S15a 9606
585 6AZ1 10 J ribosomal protein S8 5661
586 6AWB 13 K 30S ribosomal protein S8 562
587 6AWC 13 K 30S ribosomal protein S8 562
588 6AWD 12 K 30S ribosomal protein S8 562
589 5OT7 14 G 30S ribosomal protein S8 274
590 5OQL 45 w 40S ribosomal protein S22-like protein 209285
591 5OPT 22 e 40S ribosomal protein S15a, putative 5693
592 5WLC 13 LE rpS22_uS8 4932
593 5WFK 41 h 30S ribosomal protein S8 562
594 5WFS 41 h 30S ribosomal protein S8 562
595 5WF0 41 h 30S ribosomal protein S8 562
596 5XYU 7 H 30S ribosomal protein S8 1772
597 5XYI 24 W Ribosomal protein S15a 5722
598 5WE4 41 h 30S ribosomal protein S8 562
599 5WE6 41 h 30S ribosomal protein S8 562
600 5WDT 41 h 30S ribosomal protein S8 562
601 5XXU 24 W Ribosomal protein uS8 5811
602 5OA3 27 W 40S ribosomal protein S15a 9606
603 5O61 42 BH 30S ribosomal protein S8 1772
604 5O5J 8 H 30S ribosomal protein S8 1772
605 5O2R 42 h 30S ribosomal protein S8 562