3J9Y

Cryo-EM structure of tetracycline resistance protein TetM bound to a translating E.coli ribosome


Sequence Similarity Clusters for the Entities in PDB 3J9Y

Entity #1 | Chains: a
16S ribosomal RNA rna, length: 1539 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: p
30S ribosomal protein S16 protein, length: 82 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 139 180 157
95 % 139 180 205
90 % 139 180 217
70 % 139 180 238
50 % 143 184 239
40 % 143 184 251
30 % 143 184 273
Entity #11 | Chains: q
30S ribosomal protein S17 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 138 179 152
95 % 138 179 197
90 % 138 179 208
70 % 142 183 219
50 % 142 183 234
40 % 142 183 248
30 % 142 183 266
Entity #12 | Chains: r
30S ribosomal protein S18 protein, length: 75 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 105 125 231
95 % 107 129 295
90 % 107 129 305
70 % 109 131 348
50 % 109 131 409
40 % 109 131 432
30 % 109 131 450
Entity #13 | Chains: t
30S ribosomal protein S20 protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 138 178 156
95 % 138 178 202
90 % 138 178 213
70 % 138 178 237
50 % 142 182 237
40 % 165 206 223
30 % 165 206 236
Entity #14 | Chains: u
30S ribosomal protein S21 protein, length: 71 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 106 124 235
95 % 106 124 309
90 % 106 124 321
70 % 108 126 359
50 % 108 126 423
40 % 108 126 447
30 % 108 126 464
Entity #15 | Chains: v
P-site fMet-tRNAfMet rna, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #16 | Chains: x
mRNA rna, length: 11 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #17 | Chains: w
Tetracycline resistance protein TetM protein, length: 639 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 2 54115
95 % 2 3 26212
90 % 2 3 26471
70 % 2 4 20855
50 % 2 4 18452
40 % 2 4 14625
30 % 2 4 14196
Entity #18 | Chains: c
30S ribosomal protein S3 protein, length: 233 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 80 397
95 % 61 81 522
90 % 61 81 544
70 % 61 81 581
50 % 332 359 88
40 % 332 359 102
30 % 332 359 101
Entity #19 | Chains: g
30S ribosomal protein S7 protein, length: 179 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 49 69 450
95 % 137 176 212
90 % 137 176 222
70 % 49 69 675
50 % 49 69 709
40 % 49 69 734
30 % 49 69 779
Entity #2 | Chains: b
30S ribosomal protein S2 protein, length: 240 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 136 175 160
95 % 136 175 211
90 % 136 175 221
70 % 140 179 233
50 % 484 534 33
40 % 489 540 38
30 % 489 540 41
Entity #20 | Chains: i
30S ribosomal protein S9 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 137 178 154
95 % 137 178 200
90 % 137 178 214
70 % 141 182 222
50 % 480 531 34
40 % 480 531 42
30 % 480 531 44
Entity #21 | Chains: j
30S ribosomal protein S10 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 141 181 146
95 % 142 182 186
90 % 146 186 190
70 % 146 186 211
50 % 489 538 29
40 % 489 538 39
30 % 524 575 32
Entity #22 | Chains: m
30S ribosomal protein S13 protein, length: 118 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 140 182 153
95 % 140 182 198
90 % 140 182 207
70 % 144 186 218
50 % 489 542 30
40 % 492 545 37
30 % 492 545 40
Entity #23 | Chains: n
30S ribosomal protein S14 protein, length: 102 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 23 24 2276
95 % 137 175 210
90 % 137 175 220
70 % 137 175 242
50 % 143 181 238
40 % 148 187 241
30 % 149 188 251
Entity #24 | Chains: s
30S ribosomal protein S19 protein, length: 92 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 136 176 159
95 % 136 176 207
90 % 136 176 218
70 % 142 182 224
50 % 491 543 28
40 % 491 543 36
30 % 491 543 39
Entity #25 | Chains: A
23S ribosomal RNA rna, length: 2903 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #26 | Chains: B
5S ribosomal RNA rna, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #27 | Chains: C
50S ribosomal protein L2 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 142 186 142
95 % 142 186 182
90 % 142 186 196
70 % 146 190 202
50 % 414 465 50
40 % 414 465 62
30 % 414 465 62
Entity #28 | Chains: D
50S ribosomal protein L3 protein, length: 209 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 151 198 125
95 % 151 198 162
90 % 151 198 176
70 % 155 202 187
50 % 418 471 51
40 % 422 475 57
30 % 422 476 57
Entity #29 | Chains: E
50S ribosomal protein L4 protein, length: 201 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 189 133
95 % 143 189 174
90 % 143 189 185
70 % 143 189 207
50 % 147 193 225
40 % 177 226 205
30 % 405 457 70
Entity #3 | Chains: d
30S ribosomal protein S4 protein, length: 206 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 139 179 150
95 % 139 179 194
90 % 139 179 205
70 % 143 183 216
50 % 469 518 36
40 % 497 548 34
30 % 497 548 37
Entity #30 | Chains: F
50S ribosomal protein L5 protein, length: 179 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 144 193 131
95 % 144 193 168
90 % 144 193 181
70 % 144 193 205
50 % 406 460 53
40 % 406 460 64
30 % 406 460 64
Entity #31 | Chains: G
50S ribosomal protein L6 protein, length: 177 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 142 188 135
95 % 142 188 176
90 % 142 188 187
70 % 142 188 208
50 % 180 234 187
40 % 409 466 60
30 % 409 466 59
Entity #32 | Chains: H
50S ribosomal protein L9 protein, length: 149 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 128 171 164
95 % 129 172 218
90 % 129 172 229
70 % 129 172 254
50 % 130 173 279
40 % 305 351 99
30 % 318 364 94
Entity #33 | Chains: I
50S ribosomal protein L11 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 115 165 165
95 % 115 165 220
90 % 115 165 230
70 % 119 169 253
50 % 188 265 156
40 % 188 265 169
30 % 190 273 171
Entity #34 | Chains: J
50S ribosomal protein L13 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 190 126
95 % 143 190 164
90 % 143 190 177
70 % 147 194 191
50 % 186 236 186
40 % 385 438 73
30 % 385 438 74
Entity #35 | Chains: K
50S ribosomal protein L14 protein, length: 123 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 191 124
95 % 143 191 161
90 % 143 191 175
70 % 147 195 188
50 % 419 478 46
40 % 419 478 52
30 % 419 478 52
Entity #36 | Chains: L
50S ribosomal protein L15 protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 190 127
95 % 143 190 165
90 % 143 190 179
70 % 143 190 201
50 % 147 194 222
40 % 407 460 65
30 % 407 460 65
Entity #37 | Chains: M
50S ribosomal protein L16 protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 131 177 162
95 % 140 186 179
90 % 140 186 192
70 % 144 190 203
50 % 411 463 52
40 % 411 463 63
30 % 411 463 63
Entity #38 | Chains: N
50S ribosomal protein L17 protein, length: 127 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 137 183 145
95 % 143 189 171
90 % 143 189 183
70 % 147 193 195
50 % 374 423 61
40 % 410 462 56
30 % 410 464 56
Entity #39 | Chains: O
50S ribosomal protein L18 protein, length: 117 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 141 187 138
95 % 141 187 178
90 % 141 187 189
70 % 141 187 210
50 % 394 445 59
40 % 394 445 75
30 % 394 445 76
Entity #4 | Chains: e
30S ribosomal protein S5 protein, length: 167 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 139 167 163
95 % 139 180 191
90 % 139 180 202
70 % 143 184 215
50 % 485 538 31
40 % 485 538 40
30 % 485 538 42
Entity #40 | Chains: P
50S ribosomal protein L19 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 189 132
95 % 143 189 170
90 % 143 189 182
70 % 147 193 193
50 % 193 242 179
40 % 193 242 193
30 % 193 242 204
Entity #41 | Chains: Q
50S ribosomal protein L20 protein, length: 118 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 190 130
95 % 143 190 166
90 % 143 190 180
70 % 147 194 189
50 % 412 465 47
40 % 419 473 54
30 % 419 473 55
Entity #42 | Chains: R
50S ribosomal protein L21 protein, length: 103 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 186 143
95 % 143 186 180
90 % 143 186 193
70 % 143 186 212
50 % 147 190 229
40 % 411 460 66
30 % 411 460 66
Entity #43 | Chains: S
50S ribosomal protein L22 protein, length: 110 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 189 134
95 % 143 189 173
90 % 143 189 184
70 % 143 189 206
50 % 380 434 60
40 % 380 434 76
30 % 380 434 77
Entity #44 | Chains: T
50S ribosomal protein L23 protein, length: 100 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 193 121
95 % 143 193 156
90 % 143 193 171
70 % 143 193 194
50 % 147 197 218
40 % 409 466 59
30 % 409 466 60
Entity #45 | Chains: U
50S ribosomal protein L24 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 192 123
95 % 143 192 160
90 % 143 192 174
70 % 143 192 198
50 % 383 438 58
40 % 383 438 74
30 % 383 440 75
Entity #46 | Chains: V
50S ribosomal protein L25 protein, length: 94 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 142 193 120
95 % 142 193 155
90 % 142 193 170
70 % 142 193 192
50 % 143 194 210
40 % 143 194 226
30 % 143 194 242
Entity #47 | Chains: W
50S ribosomal protein L27 protein, length: 85 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 142 188 139
95 % 143 189 175
90 % 143 189 186
70 % 172 218 172
50 % 412 462 49
40 % 412 462 61
30 % 412 462 61
Entity #48 | Chains: X
50S ribosomal protein L28 protein, length: 78 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 137 173 161
95 % 137 173 215
90 % 137 173 225
70 % 141 177 245
50 % 143 179 252
40 % 143 179 267
30 % 143 179 290
Entity #49 | Chains: Y
50S ribosomal protein L29 protein, length: 63 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 193 122
95 % 143 193 158
90 % 143 193 173
70 % 143 193 197
50 % 147 197 220
40 % 338 391 89
30 % 364 417 83
Entity #5 | Chains: f
30S ribosomal protein S6 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 59 79 407
95 % 61 81 520
90 % 61 81 549
70 % 61 81 586
50 % 61 81 621
40 % 61 81 653
30 % 61 81 687
Entity #50 | Chains: Z
50S ribosomal protein L30 protein, length: 59 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 190 128
95 % 143 190 167
90 % 143 190 178
70 % 143 190 200
50 % 199 248 176
40 % 401 455 68
30 % 401 455 69
Entity #51 | Chains: 0
50S ribosomal protein L32 protein, length: 57 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 187 137
95 % 143 187 177
90 % 143 187 188
70 % 143 187 209
50 % 147 191 228
40 % 147 191 237
30 % 176 223 222
Entity #52 | Chains: 1
50S ribosomal protein L33 protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 140 186 141
95 % 140 186 183
90 % 140 186 195
70 % 144 190 204
50 % 169 215 197
40 % 371 421 81
30 % 371 421 84
Entity #53 | Chains: 2
50S ribosomal protein L34 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 143 185 144
95 % 143 185 185
90 % 143 185 197
70 % 176 218 171
50 % 411 459 54
40 % 411 459 67
30 % 411 459 67
Entity #54 | Chains: 3
50S ribosomal protein L35 protein, length: 65 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 140 182 147
95 % 140 182 187
90 % 140 182 198
70 % 140 182 223
50 % 165 208 206
40 % 165 208 221
30 % 165 208 234
Entity #55 | Chains: 4
50S ribosomal protein L36 protein, length: 38 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 136 180 151
95 % 136 180 199
90 % 136 180 210
70 % 140 184 221
50 % 349 399 80
40 % 349 399 95
30 % 349 399 92
Entity #56 | Chains: 5
50S ribosomal protein L10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 28 40 1138
95 % 33 45 1392
90 % 33 45 1413
70 % 33 45 1458
50 % 33 45 1468
40 % 33 45 1523
30 % 62 75 829
Entity #57 | Chains: 6
50S ribosomal protein L31 protein, length: 70 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 60 78 514
95 % 60 78 704
90 % 60 78 738
70 % 60 78 767
50 % 60 78 811
40 % 257 278 128
30 % 258 279 138
Entity #58 | Chains: 7
50S ribosomal protein L7/L12 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 4 28933
95 % 2 4 24821
90 % 2 4 20644
70 % 2 4 21984
50 % 2 4 16946
40 % 2 4 14754
30 % 2 4 14157
Entity #6 | Chains: h
30S ribosomal protein S8 protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 139 180 148
95 % 139 180 188
90 % 139 180 199
70 % 139 180 226
50 % 494 547 26
40 % 499 553 31
30 % 659 744 23
Entity #7 | Chains: k
30S ribosomal protein S11 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 137 178 155
95 % 137 178 203
90 % 137 178 211
70 % 137 178 234
50 % 484 536 32
40 % 484 536 41
30 % 484 536 43
Entity #8 | Chains: l
30S ribosomal protein S12 protein, length: 124 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 109 154 181
95 % 135 180 195
90 % 135 180 206
70 % 478 540 17
50 % 495 558 24
40 % 495 558 30
30 % 495 558 35
Entity #9 | Chains: o
30S ribosomal protein S15 protein, length: 89 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 124 148 189
95 % 139 181 189
90 % 139 181 200
70 % 139 181 227
50 % 498 554 25
40 % 498 554 32
30 % 498 554 36

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1SEI 1 A, B RIBOSOMAL PROTEIN S8 1422
2 4YBB 8 AH, BH 30S ribosomal protein S8 562
3 4Y4O 39 1h, 2h 30S ribosomal protein S8 274
4 5J8B 41 h 30S ribosomal protein S8 274
5 1AN7 1 A, B RIBOSOMAL PROTEIN S8 274
6 4W2F 8 AH, CH 30S Ribosomal Protein S8 274
7 6CFL 39 1h, 2h 30S Ribosomal Protein S8 274
8 6CAE 39 1h, 2h 30S ribosomal protein S8 274
9 4Y4P 39 1h, 2h 30S ribosomal protein S8 274
10 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
11 5FDV 40 1h, 2h 30S ribosomal protein S8 274
12 5J4B 39 1h, 2h 30S ribosomal protein S8 274
13 4W2G 8 AH, CH 30S Ribosomal Protein S8 274
14 6CFK 39 1h, 2h 30S ribosomal protein S8 274
15 5J7L 8 AH, BH 30S ribosomal protein S8 562
16 5W4K 39 1h, 2h 30S ribosomal protein S8 274
17 4LFB 8 H ribosomal protein S8 274
18 1VY4 8 AH, CH 30S ribosomal protein S8 274
19 4WOI 8 AH, DH 30S ribosomal protein S8 562
20 5FDU 39 1h, 2h 30S ribosomal protein S8 274
21 6I7V 12 AH, BH 30S ribosomal protein S8 562
22 4W2I 8 AH, CH 30S Ribosomal Protein S8 274
23 5JC9 8 AH, BH 30S ribosomal protein S8 562
24 1VY5 8 AH, CH 30S ribosomal protein S8 274
25 5HCQ 39 1h, 2h 30S ribosomal protein S8 274
26 4WQF 41 BH, DH 30S ribosomal protein S8 274
27 6ND5 39 1h, 2h 30S ribosomal protein S8 274
28 4W2H 8 AH, CH 30S Ribosomal Protein S8 274
29 4WPO 41 BH, DH 30S ribosomal protein S8 274
30 5J8A 8 AH, BH 30S ribosomal protein S8 562
31 4V8I 8 AH, CH 30S Ribosomal Protein S8 274
32 4JI1 8 H RIBOSOMAL PROTEIN S8 274
33 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
34 4Z3S 39 1h, 2h 30S ribosomal protein S8 274
35 5DOY 39 1h, 2h 30S Ribosomal Protein S8 274
36 5J5B 8 AH, BH 30S ribosomal protein S8 562
37 5HD1 39 1h, 2h 30S ribosomal protein S8 274
38 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
39 4DR6 8 H 30S ribosomal protein S8 274
40 4LF7 8 H ribosomal protein S8 274
41 4LF8 8 H ribosomal protein S8 274
42 5WIS 39 1h, 2h 30S ribosomal protein S8 274
43 4WSD 8 72, 7E 30S ribosomal protein S8 274
44 4WQU 41 BH, DH 30S ribosomal protein S8 274
45 5WIT 39 1h, 2h 30S ribosomal protein S8 274
46 5E81 8 72, 7E 30S ribosomal protein S8 274
47 2VQE 8 H 30S RIBOSOMAL PROTEIN S8 274
48 6GSJ 8 72, 7E 30S ribosomal protein S8 274
49 4U27 8 AH, CH 30S ribosomal protein S8 562
50 6OF1 39 1h, 2h 30S ribosomal protein S8 274
51 6CFJ 39 1h, 2h 30S ribosomal protein S8 274
52 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
53 4Z8C 39 1h, 2h 30S ribosomal protein S8 274
54 5HCR 39 1h, 2h 30S ribosomal protein S8 274
55 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
56 2UUB 8 H 30S RIBOSOMAL PROTEIN S8 274
57 4DV6 8 H ribosomal protein S8 274
58 4JYA 8 H 30S ribosomal protein S8 274
59 5IBB 8 72, 7E 30S ribosomal protein S8 274
60 4DR5 8 H 30S ribosomal protein S8 274
61 5J4C 39 1h, 2h 30S ribosomal protein S8 274
62 4KHP 8 H 30S Ribosomal protein S8 274
63 4DR2 8 H 30S ribosomal protein S8 274
64 4WRO 12 7E 30S ribosomal protein S8 274
65 4WQ1 8 72, 7E 30S ribosomal protein S8 274
66 4LF9 8 H ribosomal protein S8 274
67 4WQY 41 BH, DH 30S ribosomal protein S8 274
68 4DUY 8 H ribosomal protein S8 274
69 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
70 4DV7 8 H ribosomal protein S8 274
71 4WRA 8 72, 7E 30S ribosomal protein S8 274
72 1S03 2 G, H 30S ribosomal protein S8 562
73 5IB7 8 72, 7E 30S ribosomal protein S8 274
74 4U26 8 AH, CH 30S ribosomal protein S8 562
75 4X64 8 H 30S ribosomal protein S8 274
76 5HCP 39 1h, 2h 30S ribosomal protein S8 274
77 5IT8 8 AH, BH 30S ribosomal protein S8 562
78 4V9D 8 AH, BH 30S ribosomal protein S8 562
79 4V9P 40 BH, DH, FH, HH 30S ribosomal protein S8 562
80 4V9H 21 AH 30S ribosomal protein S8 274
81 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
82 5J91 8 AH, BH 30S ribosomal protein S8 562
83 4V8D 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
84 5WNT 8 H RIBOSOMAL PROTEIN S8 274
85 4DR3 8 H 30S ribosomal protein S8 274
86 4V90 8 AH 30S RIBOSOMAL PROTEIN S8 274
87 4JI3 8 H RIBOSOMAL PROTEIN S8 274
88 4WQR 8 72, 7E 30S ribosomal protein S8 274
89 4JI6 8 H RIBOSOMAL PROTEIN S8 274
90 4JI8 8 H RIBOSOMAL PROTEIN S8 274
91 2UXC 8 H RIBOSOMAL PROTEIN S8 274
92 5IB8 8 72, 7E 30S ribosomal protein S8 274
93 4V9R 8 AH, CH 30S Ribosomal Protein S8 274
94 4B3M 8 H 30S RIBOSOMAL PROTEIN S8 274
95 5EL6 8 72, 7E 30S ribosomal protein S8 274
96 6O97 39 1h, 2h 30S ribosomal protein S8 274
97 5EL7 8 72, 7E 30S ribosomal protein S8 274
98 5VP2 39 1h, 2h 30S ribosomal protein S8 274
99 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
100 4LF4 8 H ribosomal protein S8 274
101 5DFE 42 QH, XH 30S ribosomal protein S8 274
102 5NDK 50 72, 7E 30S ribosomal protein S8 274
103 4LF6 8 H ribosomal protein S8 274
104 4JI7 8 H RIBOSOMAL PROTEIN S8 274
105 5J88 8 AH, BH 30S ribosomal protein S8 562
106 4U24 8 AH, CH 30S ribosomal protein S8 562
107 4WU1 8 72, 7E 30S ribosomal protein S8 274
108 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
109 6QNR 8 72, 7E 30S ribosomal protein S8 274
110 5EL4 8 72, 7E 30S ribosomal protein S8 274
111 5WNV 8 H 30S ribosomal protein S8 274
112 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
113 4B3T 8 H 30S RIBOSOMAL PROTEIN S8 274
114 4WR6 8 72, 7E 30S ribosomal protein S8 274
115 4V8B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
116 5HAU 41 1h, 2h 30S ribosomal protein S8 274
117 4V9O 41 BH, DH, FH, HH 30S ribosomal protein S8 562
118 6MPF 8 H 30S ribosomal protein S8 274
119 2VQF 8 H 30S RIBOSOMAL PROTEIN S8 274
120 2UUA 8 H 30S RIBOSOMAL PROTEIN S8 274
121 4V87 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
122 4WF1 8 AH, CH 30S ribosomal protein S8 562
123 4U25 8 AH, CH 30S ribosomal protein S8 562
124 4V95 8 AH, CH 30S Ribosomal Protein S8 274
125 4WWW 39 QH, XH 30S ribosomal protein S8 562
126 4V7T 8 AH, CH 30S ribosomal protein S8 562
127 1VY7 8 AH, CH 30S ribosomal protein S8 274
128 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
129 5E7K 8 72, 7E 30S ribosomal protein S8 274
130 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
131 5EL5 8 72, 7E 30S ribosomal protein S8 274
132 6FKR 39 1h, 2h 30S ribosomal protein S8 274
133 4B3R 8 H 30S RIBOSOMAL PROTEIN S8 274
134 4LNT 8 QH, XH 30S ribosomal protein S8 274
135 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
136 4DR1 8 H 30S ribosomal protein S8 274
137 4LFA 8 H ribosomal protein S8 274
138 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
139 4DV4 8 H ribosomal protein S8 274
140 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
141 4YZV 8 QH, XH 30S ribosomal protein S8 274
142 4JI0 8 H ribosomal protein S8 274
143 5IWA 7 H 30S ribosomal protein S8 274
144 4V7U 8 AH, CH 30S ribosomal protein S8 562
145 4V9S 8 AH, CH 30S Ribosomal Protein S8 274
146 4JI2 8 H RIBOSOMAL PROTEIN S8 274
147 4V6C 7 AH, CH 30S ribosomal protein S8 562
148 4JV5 8 H 30S ribosomal protein S8 274
149 4DR7 8 H 30S ribosomal protein S8 274
150 1J5E 8 H 30S RIBOSOMAL PROTEIN S8 274
151 4GKK 8 H 30S ribosomal protein S8 274
152 4DUZ 8 H ribosomal protein S8 274
153 5NDJ 50 72, 7E 30S ribosomal protein S8 274
154 4V7V 8 AH, CH 30S ribosomal protein S8 562
155 4X65 8 H 30S ribosomal protein S8 274
156 4V8G 8 AH, CH 30S Ribosomal Protein S8 274
157 4GKJ 8 H 30S ribosomal protein S8 274
158 4DV3 8 H ribosomal protein S8 274
159 4V7S 8 AH, CH 30S ribosomal protein S8 562
160 4DV5 8 H ribosomal protein S8 274
161 5DAT 24 D2 40S ribosomal protein S22-A 4932
162 5DAT 80 d2 40S ribosomal protein S22-A 4932
163 2UUC 8 H 30S RIBOSOMAL PROTEIN S8 274
164 4LFC 8 H ribosomal protein S8 274
165 1FJG 9 H 30S RIBOSOMAL PROTEIN S8 274
166 3T1Y 8 H 30S ribosomal protein S8 274
167 4WZO 8 72, 7E 30S ribosomal protein S8 274
168 4JI4 8 H RIBOSOMAL PROTEIN S8 274
169 1VY6 8 AH, CH 30S ribosomal protein S8 274
170 1XMQ 10 H 30S Ribosomal Protein S8 274
171 5WNP 8 H 30S ribosomal protein S8 274
172 6CAP 8 H 30S ribosomal protein S8 274
173 4U20 8 AH, CH 30S ribosomal protein S8 562
174 6MPI 8 H 30S ribosomal protein S8 274
175 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
176 4DV0 8 H ribosomal protein S8 274
177 4V9B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
178 4U1V 8 AH, CH 30S ribosomal protein S8 562
179 4V6F 38 BK, CK 30S ribosomal protein S8 274
180 4X62 8 H 30S ribosomal protein S8 274
181 4V8F 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
182 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
183 4B3S 8 H 30S RIBOSOMAL PROTEIN S8 274
184 4DV2 8 H ribosomal protein S8 274
185 4DV1 8 H ribosomal protein S8 274
186 5WNU 8 H 30S ribosomal protein S8 274
187 1N32 10 H 30S RIBOSOMAL PROTEIN S8 274
188 5F8K 39 1h, 2h 30S ribosomal protein S8 274
189 1I94 8 H 30S RIBOSOMAL PROTEIN S8 274
190 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
191 4V8H 8 AH, CH 30S Ribosomal Protein S8 274
192 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
193 4JI5 8 H RIBOSOMAL PROTEIN S8 274
194 6CAQ 8 H 30S ribosomal protein S8 274
195 4K0K 8 H 30S ribosomal protein S8 274
196 4W2E 41 h 30S ribosomal protein S8 274
197 4V8C 38 CK, DK 30S RIBOSOMAL PROTEIN S8 274
198 5BR8 8 H 30S ribosomal protein S8 274
199 4LF5 8 H ribosomal protein S8 274
200 5J4D 42 QA, VC 30S ribosomal protein S8 274
201 4V9A 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
202 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
203 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
204 4V5J 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
205 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
206 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
207 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
208 6ND6 39 1h, 2h 30S ribosomal protein S8 274
209 4V7Y 8 AH, CH 30S ribosomal protein S8 274
210 6UO1 39 1h, 2h 30S ribosomal protein S8 274
211 6GSK 8 72, 7E 30S ribosomal protein S8 274
212 4V9C 8 AH, CH 30S ribosomal protein S8 562
213 4V8E 38 BK, DK 30S RIBOSOMAL PROTEIN S8 274
214 5J30 39 QH, XH 30S ribosomal protein S8 274
215 6QNQ 8 72, 7E 30S ribosomal protein S8 274
216 4DR4 8 H 30S ribosomal protein S8 274
217 4WZD 8 72, 7E 30S ribosomal protein S8 274
218 3OTO 8 H 30S RIBOSOMAL PROTEIN S8 274
219 4X66 8 H 30S ribosomal protein S8 274
220 2UU9 8 H 30S RIBOSOMAL PROTEIN S8 274
221 4V8Q 42 BH 30S RIBOSOMAL PROTEIN S8 274
222 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
223 4V85 8 AH 30S ribosomal protein S8 562
224 1HR0 9 H 30S RIBOSOMAL PROTEIN S8 274
225 4AQY 8 H 30S RIBOSOMAL PROTEIN S8 274
226 4W4G 8 QH, XH 30S ribosomal protein S8 274
227 4NXM 8 H ribosomal protein S8 274
228 4V5L 8 AH 30S RIBOSOMAL PROTEIN S8 274
229 4YPB 8 QH, XH 30S ribosomal protein S8 274
230 4V7X 8 AH, CH 30S ribosomal protein S8 274
231 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
232 4U1U 8 AH, CH 30S ribosomal protein S8 562
233 4ZER 39 1h, 2h 30S ribosomal protein S8 274
234 1IBL 11 H 30S RIBOSOMAL PROTEIN S8 274
235 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
236 4V7W 8 AH, CH 30S ribosomal protein S8 274
237 4WT1 8 72, 7E 30S ribosomal protein S8 274
238 6C5L 8 AH, CH 30S ribosomal protein S8 274
239 4WT8 8 AH, BH 30S ribosomal protein S8 274
240 5DOX 39 1h, 2h 30S ribosomal protein S8 274
241 6OTR 8 QH, XH 30S ribosomal protein S8 274
242 4NXN 8 H ribosomal protein S8 274
243 1XNR 10 H 16S Ribosomal protein S8 274
244 4LT8 8 QH, XH 30S ribosomal protein S8 274
245 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
246 5WNQ 8 H 30S ribosomal protein S8 274
247 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
248 6MKN 8 H 30S ribosomal protein S8 274
249 4V51 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
250 6DTI 8 H 30S ribosomal protein S8 274
251 4V7L 8 AH, CH 30S ribosomal protein S8 274
252 4V5R 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
253 1HNZ 9 H 30S RIBOSOMAL PROTEIN S8 274
254 1XNQ 10 H Ribosomal protein S8 274
255 4V8A 38 CH, DH 30S ribosomal protein S8 274
256 4V5K 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
257 4V5Q 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
258 4V7J 7 Ah, Bh 30S ribosomal protein S8 274
259 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
260 6BZ6 8 QH, XH 30S ribosomal protein S8 274
261 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
262 5J3C 39 QH, XH 30S ribosomal protein S8 274
263 4V5C 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
264 4V5E 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
265 4L47 8 QH, XH 30S ribosomal protein S8 274
266 4V5P 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
267 5V8I 39 1h, 2h 30S ribosomal protein S8 274
268 4ZSN 8 QH, XH 30S ribosomal protein S8 274
269 4V5D 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
270 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
271 6CZR 39 1h, 2h 30S ribosomal protein S8 274
272 6OXA 8 QH, XH 30S ribosomal protein S8 274
273 6BUW 8 QH, XH 30S ribosomal protein S8 274
274 4V7Z 8 AH, CH 30S ribosomal protein S8 274
275 4V8X 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
276 4V5S 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
277 4V9I 8 AH, CH 30S Ribosomal protein S8 274
278 1XMO 10 H 30S ribosomal protein S8 274
279 3T1H 8 H 30S ribosomal protein S8 274
280 2UXD 8 H RIBOSOMAL PROTEIN S8 274
281 1N33 10 H 30S RIBOSOMAL PROTEIN S8 274
282 1IBK 9 H 30S RIBOSOMAL PROTEIN S8 274
283 4V6G 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
284 4V8N 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
285 4V97 8 AH, CH 30S ribosomal protein S8 274
286 6CAR 8 H 30S ribosomal protein S8 274
287 1HNW 9 H 30S RIBOSOMAL PROTEIN S8 274
288 4V7M 8 AH, CH 30S ribosomal protein S8 274
289 4WSM 8 72, 7E 30S ribosomal protein S8 274
290 4TUD 8 QH, XH 30S ribosomal protein S8 274
291 1IBM 11 H 30S RIBOSOMAL PROTEIN S8 274
292 5WNR 8 H 30S ribosomal protein S8 274
293 6CAO 8 H 30S ribosomal protein S8 274
294 4V6A 8 AH, CH 30S ribosomal protein S8 274
295 4TUE 8 QH, XH 30S ribosomal protein S8 274
296 6OXI 8 QH, XH 30S ribosomal protein S8 274
297 4TUA 8 QH, XH 30S ribosomal protein S8 274
298 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
299 4V84 8 AH, CH 30S ribosomal protein S8 274
300 5WNS 8 H 30S ribosomal protein S8 274
301 6NDK 8 QH, XH 30S ribosomal protein S8 274
302 4V7K 7 Ah, Bh 30S ribosomal protein S8 274
303 4YY3 8 H 30S ribosomal protein S8 274
304 1HNX 9 H 30S RIBOSOMAL PROTEIN S8 274
305 4V9Q 38 BH, DH 30S ribosomal protein S8 274
306 6BZ8 8 QH, XH 30S ribosomal protein S8 274
307 4TUC 8 QH, XH 30S ribosomal protein S8 274
308 4YHH 8 H 30S ribosomal protein S8 274
309 5VPO 9 QH, XH 30S ribosomal protein S8 274
310 6NY6 8 H 30S ribosomal protein S8 274
311 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
312 4TUB 8 QH, XH 30S ribosomal protein S8 274
313 4V9N 11 AH, CH 30S ribosomal protein S8 274
314 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
315 4P70 8 QH, XH 30S ribosomal protein S8 274
316 4V8U 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
317 4LSK 8 QH, XH 30S ribosomal protein S8 274
318 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
319 4V6D 7 AH, CH 30S ribosomal protein S8 562
320 4P6F 8 QH, XH 30S ribosomal protein S8 274
321 4V67 10 AH, CH 30S ribosomal protein S8 274
322 4V83 8 AH, CH 30S ribosomal protein S8 274
323 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
324 4V5F 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
325 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
326 1VVJ 8 QH, XH 30S ribosomal protein S8 274
327 4LFZ 8 QH, XH 30S ribosomal protein S8 274
328 2E5L 9 H 30S ribosomal protein S8 274
329 6BZ7 8 QH, XH 30S ribosomal protein S8 274
330 6N1D 42 AS08, BS08 30S ribosomal protein S8 274
331 4V6E 7 AH, CH 30S ribosomal protein S8 562
332 6CAS 8 H 30S ribosomal protein S8 274
333 4V52 7 AH, CH 30S ribosomal protein S8 562
334 5CZP 39 QH, XH 30S ribosomal protein S8 274
335 6N9F 39 1h, 2h 30S Ribosomal Protein S8 274
336 6N9E 39 1h, 2h 30S Ribosomal Protein S8 274
337 2HHH 8 H 30S ribosomal protein S8 274
338 4V89 8 AH 30S ribosomal protein S8 562
339 4OX9 8 H 30S ribosomal protein S8 274
340 4V54 7 AH, CH 30S ribosomal protein S8 562
341 2UXB 8 H RIBOSOMAL PROTEIN S8 274
342 1I96 8 H 30S RIBOSOMAL PROTEIN S8 274
343 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
344 4V9K 7 AH, CH 30S ribosomal protein S8 274
345 4V50 10 AH, CH 30S ribosomal protein S8 562
346 1N34 9 H 30S RIBOSOMAL PROTEIN S8 274
347 4V57 7 AH, CH 30S ribosomal protein S8 562
348 4V5A 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
349 4V63 10 AH, CH 30S ribosomal protein S8 274
350 4L71 8 QH, XH 30S ribosomal protein S8 274
351 4KVB 8 H 30S ribosomal protein S8 274
352 4XEJ 35 AS08, BS08 30S ribosomal protein S8 274
353 4V64 7 AH, CH 30S ribosomal protein S8 562
354 4V7P 8 AH, DH 30S ribosomal protein S8 274
355 4V8J 8 AH, CH 30S ribosomal protein S8 274
356 1N36 8 H 30S RIBOSOMAL PROTEIN S8 274
357 2ZM6 8 H 30S ribosomal protein S8 274
358 4V4H 7 AH, CH 30S RIBOSOMAL PROTEIN S8 562
359 4V4Q 7 AH, CH 30S ribosomal protein S8 562
360 4V5B 40 BH, DH 30S RIBOSOMAL PROTEIN S8 RESIDUES 2-130 562
361 5D8B 35 EC, IA 30S ribosomal protein S8 274
362 6BY1 43 AH, BH 30S ribosomal protein S8 562
363 4LEL 8 QH, XH 30S ribosomal protein S8 274
364 4V53 7 AH, CH 30S ribosomal protein S8 562
365 2F4V 9 H 30S ribosomal protein S8 274
366 4V9L 7 AH, CH 30S ribosomal protein S8 274
367 1FKA 8 H 30S RIBOSOMAL PROTEIN S8 274
368 4V5G 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
369 4V56 7 AH, CH 30S ribosomal protein S8 562
370 1I97 8 H 30S RIBOSOMAL PROTEIN S8 274
371 4V9J 7 AH, CH 30S ribosomal protein S8 274
372 4V55 7 AH, CH 30S ribosomal protein S8 562
373 1I95 8 H 30S RIBOSOMAL PROTEIN S8 274
374 4V8O 8 AH 30S RIBOSOMAL PROTEIN S8 274
375 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
376 4V9M 7 AH, CH 30S ribosomal protein S8 274
377 4W29 7 AH, CH 30S ribosomal protein S8 274
378 4V5Y 7 AH, CH 30S ribosomal protein S8 562
379 4V4Y 10 AK 30S ribosomal protein S8 274
380 4V4J 41 i 30S ribosomal protein S8 274
381 4V4X 10 AK 30S ribosomal protein S8 274
382 4V4Z 11 AK 30S ribosomal protein S8 274
383 4V4I 41 i 30S ribosomal protein S8 274
384 4V4P 43 BK 30S ribosomal protein S8 274
385 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
386 4V4R 11 AH 30S ribosomal protein S8 274
387 4V4S 11 AH 30S ribosomal protein S8 274
388 4V4T 11 AH 30S ribosomal protein S8 274
389 4KZZ 23 W 40S Ribosomal Protein S15A 9986
390 4KZX 23 W 40S ribosomal protein S15A 9986
391 4KZY 23 W 40S Ribosomal Protein S15A 9986
392 4V49 10 AH 30S ribosomal protein S8 562
393 4V4A 8 AH 30S ribosomal protein S8 562
394 4V4G 8 AH, CH, EH, GH, IH 30S ribosomal protein S8 562
395 6SZS 39 h 30S ribosomal protein S8 562
396 6SPC 8 h 30S ribosomal protein S8 287
397 6SPE 8 h 30S ribosomal protein S8 287
398 6SPF 40 h 30S ribosomal protein S8 287
399 6SPG 8 h 30S ribosomal protein S8 287
400 6SGC 24 X1 Ribosomal protein S15a 9986
401 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
402 6S0X 38 h 30S ribosomal protein S8 1280
403 6S13 38 h 30S ribosomal protein S8 1280
404 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
405 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
406 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
407 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
408 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
409 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
410 6P5I 24 X uS8 9986
411 6P5J 24 X uS8 9986
412 6P5K 70 X uS8 9986
413 6P5N 70 X uS8 9986
414 6P4G 24 X uS8 9986
415 6P4H 25 X uS8 9986
416 6OUO 40 m 30S ribosomal protein S8 562
417 6RM3 69 SW0 uS8 6039
418 6OSQ 41 m 30S ribosomal protein S8 562
419 6OST 38 m 30S ribosomal protein S8 562
420 6OT3 40 m 30S ribosomal protein S8 562
421 6OSK 40 m 30S ribosomal protein S8 562
422 6ORE 42 m 30S ribosomal protein S8 562
423 6ORL 38 m 30S ribosomal protein S8 562
424 6OM7 29 SW 40S ribosomal protein S15a 9606
425 6OLZ 69 BW 40S ribosomal protein S15a 9606
426 6OM0 29 SW 40S ribosomal protein S15a 9606
427 6OLE 29 SW 40S ribosomal protein S15a 9606
428 6OLF 29 SW 40S ribosomal protein S15a 9606
429 6OLG 72 BW 40S ribosomal protein S15a 9606
430 6OLI 29 SW 40S ribosomal protein S15a 9606
431 6OKK 11 K 40S ribosomal protein S15A 5833
432 6RBD 15 W 40S ribosomal protein S22-A 4932
433 6RBE 15 W 40S ribosomal protein S22-A 4932
434 6OGF 35 M 30S ribosomal protein S8 562
435 6OGG 35 M 30S ribosomal protein S8 562
436 6OGI 35 M 30S ribosomal protein S8 562
437 6OFX 35 M 30S ribosomal protein S8 562
438 6OG7 35 M 30S ribosomal protein S8 562
439 6R7Q 82 TT Ribosomal protein S15a 9986
440 6R6G 50 TT Ribosomal protein S15a 9986
441 6R6P 66 TT Ribosomal protein S15a 9986
442 6R5Q 74 TT Ribosomal protein S15a 9986
443 6O9J 38 h 30S ribosomal protein S8 562
444 6O9K 8 h 30S ribosomal protein S8 562
445 6QZP 76 SW 40S ribosomal protein S15a 9606
446 6O7K 22 p 30S ribosomal protein S8 562
447 6NQB 9 H 30S ribosomal protein S8 562
448 6Q95 8 m 30S ribosomal protein S8 274
449 6Q97 45 m 30S ribosomal protein S8 562
450 6Q98 43 m 30S ribosomal protein S8 562
451 6Q9A 43 m 30S ribosomal protein S8 562
452 6Q8Y 27 b 40S ribosomal protein S22-A 4932
453 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
454 6IP5 75 3M 40S ribosomal protein S15a 9606
455 6IP6 74 3M 40S ribosomal protein S15a 9606
456 6IP8 74 3M 40S ribosomal protein S15a 9606
457 6MTB 73 WW 40S ribosomal protein S15a 9986
458 6MTC 72 WW 40S ribosomal protein S15a 9986
459 6MTD 74 WW uS8 9986
460 6MTE 73 WW uS8 9986
461 6HTQ 37 h 30S ribosomal protein S8 1423
462 6HRM 40 m 30S ribosomal protein S8 562
463 6HCQ 27 X2 Ribosomal protein S15a 9986
464 6HCJ 27 X2 Ribosomal protein S15a 9986
465 6HCM 24 X1 Ribosomal protein S15a 9986
466 6HCF 24 X1 Ribosomal protein S15a 9986
467 6HA1 38 h 30S ribosomal protein S8 1423
468 6HA8 40 h 30S ribosomal protein S8 1423
469 6H58 39 h, hh 30S ribosomal protein S8 562
470 6H4N 8 h 30S ribosomal protein S8 562
471 6DZI 8 q 30S ribosomal protein S8 1772
472 6DZK 8 H 30S ribosomal protein S8 1772
473 6GZX 38 H3, H4 30S ribosomal protein S8 274
474 6GZZ 38 H3, H4 30S ribosomal protein S8 274
475 6GZQ 38 H2 30S ribosomal protein S8 274
476 6GZ3 33 BW Ribosomal protein S15a 9986
477 6GZ4 36 BW ribosomal protein uS8 9986
478 6GZ5 33 BW ribosomal protein uS8 9986
479 6GXM 41 h 30S ribosomal protein S8 562
480 6GXN 41 h 30S ribosomal protein S8 562
481 6GXO 41 h 30S ribosomal protein S8 562
482 6GXP 40 h 30S ribosomal protein S8 562
483 6GWT 41 h 30S ribosomal protein S8 562
484 6GSL 8 72, 7E 30S ribosomal protein S8 274
485 6GSM 26 W 40S ribosomal protein S22 28985
486 6GSN 40 W 40S ribosomal protein S22 28985
487 6GQV 70 AM 40S ribosomal protein S22-A 4932
488 6GQ1 70 AM 40S ribosomal protein S22-A 4932
489 6GQB 70 AM 40S ribosomal protein S22-A 4932
490 6DNC 45 UA 30S ribosomal protein S8 562
491 6D9J 72 XX uS8 9986
492 6D90 73 XX uS8 9986
493 5ZLU 15 N 30S ribosomal protein S8 274
494 6G5H 14 W 40S ribosomal protein S15a 9606
495 6G5I 24 W 40S ribosomal protein S15a 9606
496 6G4S 19 W 40S ribosomal protein S15a 9606
497 6G4W 16 W 40S ribosomal protein S15a 9606
498 6G51 15 W 40S ribosomal protein S15a 9606
499 6G53 15 W 40S ribosomal protein S15a 9606
500 6G18 25 W 40S ribosomal protein S15a 9606
501 6FYX 26 W 40S ribosomal protein S22 28985
502 6FYY 26 W 40S ribosomal protein S22 28985
503 6FXC 8 Ah, Bh 30S ribosomal protein S8 1280
504 5ZEU 5 h 30S ribosomal protein S8 1772
505 5ZEB 5 h 30S ribosomal protein S8 1772
506 5ZEP 5 h 30S ribosomal protein S8 1772
507 6C4I 41 h 30S ribosomal protein S8 562
508 6FEC 29 a 40S ribosomal protein S15a 9606
509 6FAI 33 W 40S ribosomal protein S22-A 4932
510 6BU8 38 H 30S ribosomal protein S8 562
511 6BOH 42 RA, WC 30S ribosomal protein S8 274
512 6BOK 41 PA, SC 30S ribosomal protein S8 274
513 6ERI 41 BH 30S ribosomal protein S8, chloroplastic 3562
514 6ENU 8 h 30S ribosomal protein S8 562
515 6ENJ 38 h 30S ribosomal protein S8 562
516 6ENF 8 h 30S ribosomal protein S8 562
517 6EML 24 b 40S ribosomal protein S22-A 4932
518 6B4V 42 QA, UC 30S ribosomal protein S8 274
519 6EK0 76 SW 40S ribosomal protein S15a 9606
520 6AZ1 10 J ribosomal protein S8 5661
521 6AWB 13 K 30S ribosomal protein S8 562
522 6AWC 13 K 30S ribosomal protein S8 562
523 6AWD 12 K 30S ribosomal protein S8 562
524 5OT7 14 G 30S ribosomal protein S8 274
525 5OQL 45 w 40S ribosomal protein S22-like protein 209285
526 5OPT 22 e 40S ribosomal protein S15a, putative 5693
527 5WLC 13 LE rpS22_uS8 4932
528 5WFK 41 h 30S ribosomal protein S8 562
529 5WFS 41 h 30S ribosomal protein S8 562
530 5WF0 41 h 30S ribosomal protein S8 562
531 5XYU 7 H 30S ribosomal protein S8 1772
532 5XYI 24 W Ribosomal protein S15a 5722
533 5WE4 41 h 30S ribosomal protein S8 562
534 5WE6 41 h 30S ribosomal protein S8 562
535 5WDT 41 h 30S ribosomal protein S8 562
536 5XXU 24 W Ribosomal protein uS8 5811
537 5OA3 27 W 40S ribosomal protein S15a 9606
538 5O61 42 BH 30S ribosomal protein S8 1772
539 5O5J 8 H 30S ribosomal protein S8 1772
540 5O2R 42 h 30S ribosomal protein S8 562
541 5NWY 42 7 30S ribosomal protein S8 562
542 5VPP 37 QH, XH 30S ribosomal protein S8 274
543 5NP6 11 K 30S ribosomal protein S8 562
544 5NO2 6 H 30S ribosomal protein S8 562
545 5NO3 7 H 30S ribosomal protein S8 562
546 5NO4 7 H 30S ribosomal protein S8 562
547 5NJT 8 H 30S ribosomal protein S8 1423
548 5V93 39 h 30S ribosomal protein S8 1773
549 5NGM 8 Ah 30S ribosomal protein S8 1280
550 5ND8 8 h 30S ribosomal protein S8 1280
551 5ND9 8 h 30S ribosomal protein S8 1280
552 5X8P 38 h 30S ribosomal protein S8, chloroplastic 3562
553 5X8R 6 h 30S ribosomal protein S8, chloroplastic 3562
554 5UYK 38 H 30S ribosomal protein S8 562
555 5UYL 38 H 30S ribosomal protein S8 562
556 5UYM 38 H 30S ribosomal protein S8 562
557 5UYN 38 H 30S ribosomal protein S8 562
558 5UYP 38 H 30S ribosomal protein S8 562
559 5UYQ 38 H 30S ribosomal protein S8 562
560 5UZ4 7 H 30S ribosomal protein S8 562
561 5UQ7 39 h 30S ribosomal protein S8 274
562 5UQ8 39 h 30S ribosomal protein S8 274
563 5MYJ 8 AH 30S ribosomal protein S8 1358
564 5MY1 7 H 30S ribosomal protein S8 562
565 5WYJ 47 SX 40S ribosomal protein S22-A 4932
566 5WYK 43 SX 40S ribosomal protein S22-A 4932
567 5U9F 46 H 30S ribosomal protein S8 562
568 5U9G 46 H 30S ribosomal protein S8 562
569 5MMM 44 h 30S ribosomal protein S8, chloroplastic 3562
570 5MMJ 10 h 30S ribosomal protein S8, chloroplastic 3562
571 5U4I 39 h 30S ribosomal protein S8 Gene Name(s): rpsH b3306 JW3268 562
572 5TZS 14 E rpS22_uS8 4932
573 5MGP 39 h 30S ribosomal protein S8 562
574 5ME0 8 H 30S ribosomal protein S8 Taken from PDB entry 4YBB 562
575 5ME1 8 H 30S ribosomal protein S8 Taken from PDB entry 4YBB 562
576 5MDV 45 m 30S ribosomal protein S8 562
577 5MDW 45 m 30S ribosomal protein S8 562
578 5MDY 45 m 30S ribosomal protein S8 562
579 5MDZ 43 m 30S ribosomal protein S8 562
580 5H5U 46 o 30S ribosomal protein S8 562
581 5MC6 29 b 40S ribosomal protein S22-A 4932
582 5M1J 30 W2 40S ribosomal protein S22-A 4932
583 5LZS 73 WW uS8 9986
584 5LZT 74 WW uS8 9986
585 5LZU 73 WW uS8 9986
586 5LZV 74 WW uS8 9986
587 5LZW 74 WW uS8 9986
588 5LZX 74 WW uS8 9986
589 5LZY 72 WW uS8 9986
590 5LZZ 74 WW uS8 9986
591 5LZA 8 h 30S ribosomal protein S8 562
592 5LZB 8 h 30S ribosomal protein S8 562
593 5LZC 8 h 30S ribosomal protein S8 562
594 5LZD 8 h 30S ribosomal protein S8 562
595 5LZE 8 h 30S ribosomal protein S8 562
596 5LZF 8 h 30S ribosomal protein S8 562
597 5TCU 7 SF 30S ribosomal protein S8 1280
598 5T7V 13 SF 30S ribosomal protein S8 1280
599 5T2A 65 AJ uS8 5661
600 5T2C 57 AP 40S ribos