
Crystal structure of Lactimidomycin bound to the yeast 80S ribosome

Sequence Similarity Clusters for the Entities in PDB 4U4R

Entity #1 | Chains: 2,6
18S ribosomal RNA rna, length: 1800 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: S8,s8
40S ribosomal protein S8-A protein, length: 200 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 410
95 % 2 70 526
90 % 2 76 506
70 % 2 93 458
50 % 2 190 256
40 % 2 194 260
30 % 2 194 275
Entity #11 | Chains: S9,s9
40S ribosomal protein S9-A protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 349
95 % 2 80 455
90 % 2 92 424
70 % 2 185 250
50 % 2 200 233
40 % 2 208 233
30 % 2 208 246
Entity #12 | Chains: C0,c0
40S ribosomal protein S10-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 19 1489
95 % 2 65 621
90 % 2 68 623
70 % 2 84 532
50 % 2 84 562
40 % 2 84 599
30 % 2 84 621
Entity #13 | Chains: C1,c1
40S ribosomal protein S11-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 362
95 % 2 78 465
90 % 2 90 432
70 % 2 95 448
50 % 2 197 242
40 % 2 197 253
30 % 2 197 266
Entity #14 | Chains: C2,c2
40S ribosomal protein S12 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 33 1131
95 % 2 51 768
90 % 2 53 766
70 % 2 85 501
50 % 2 85 531
40 % 2 88 556
30 % 2 88 580
Entity #15 | Chains: C3,c3
40S ribosomal protein S13 protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 363
95 % 2 78 468
90 % 2 90 433
70 % 2 194 240
50 % 2 197 243
40 % 2 205 237
30 % 2 206 249
Entity #16 | Chains: C4,c4
40S ribosomal protein S14-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 351
95 % 2 92 411
90 % 2 92 426
70 % 2 198 224
50 % 2 199 237
40 % 2 199 247
30 % 2 199 260
Entity #17 | Chains: C5,c5
40S ribosomal protein S15 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 58 530
95 % 2 68 551
90 % 2 68 575
70 % 2 86 494
50 % 2 179 298
40 % 2 187 286
30 % 2 187 305
Entity #18 | Chains: C6,c6
40S ribosomal protein S16-A protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 346
95 % 2 92 410
90 % 2 92 425
70 % 2 92 457
50 % 2 190 251
40 % 2 198 251
30 % 2 199 262
Entity #19 | Chains: C7,c7
40S ribosomal protein S17-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 415
95 % 2 70 531
90 % 2 82 488
70 % 2 82 515
50 % 2 176 301
40 % 2 176 310
30 % 2 176 331
Entity #2 | Chains: S0,s0
40S ribosomal protein S0-A protein, length: 251 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 602
95 % 2 51 779
90 % 2 51 811
70 % 2 59 760
50 % 2 68 710
40 % 2 133 402
30 % 2 133 416
Entity #20 | Chains: C8,c8
40S ribosomal protein S18-A protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 370
95 % 2 76 476
90 % 2 88 450
70 % 2 183 254
50 % 2 192 248
40 % 2 202 241
30 % 2 202 255
Entity #21 | Chains: C9,c9
40S ribosomal protein S19-A protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 74 372
95 % 2 74 485
90 % 2 74 511
70 % 2 86 486
50 % 2 174 306
40 % 2 174 317
30 % 2 177 324
Entity #22 | Chains: D0,d0
40S ribosomal protein S20 protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 74 376
95 % 2 74 484
90 % 2 74 510
70 % 2 86 487
50 % 2 86 519
40 % 2 88 535
30 % 2 88 564
Entity #23 | Chains: D1,d1
40S ribosomal protein S21-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 384
95 % 2 73 502
90 % 2 85 469
70 % 2 85 498
50 % 2 171 316
40 % 2 171 328
30 % 2 171 345
Entity #24 | Chains: D2,d2
40S ribosomal protein S22-A protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 352
95 % 2 94 408
90 % 2 94 423
70 % 2 201 232
50 % 3 212 221
40 % 3 214 227
30 % 3 214 238
Entity #25 | Chains: D3,d3
40S ribosomal protein S23-A protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 365
95 % 2 90 424
90 % 2 90 440
70 % 2 204 214
50 % 2 214 219
40 % 2 214 228
30 % 2 214 239
Entity #26 | Chains: D4,d4
40S ribosomal protein S24-A protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 364
95 % 2 78 473
90 % 2 90 443
70 % 2 95 451
50 % 2 192 263
40 % 2 192 276
30 % 2 192 291
Entity #27 | Chains: D5,d5
40S ribosomal protein S25-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 50 590
95 % 2 50 795
90 % 2 50 824
70 % 2 58 769
50 % 2 58 803
40 % 2 58 831
30 % 2 60 846
Entity #28 | Chains: D6,d6
40S ribosomal protein S26-B protein, length: 97 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 47 566
95 % 1 47 751
90 % 1 51 756
70 % 1 51 776
50 % 1 85 548
40 % 1 85 583
30 % 1 85 603
Entity #29 | Chains: D7,d7
40S ribosomal protein S27-A protein, length: 81 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 377
95 % 2 87 435
90 % 2 87 458
70 % 2 175 270
50 % 2 187 264
40 % 2 187 277
30 % 2 187 293
Entity #3 | Chains: S1,s1
40S ribosomal protein S1-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 381
95 % 2 74 493
90 % 2 84 474
70 % 2 91 463
50 % 2 97 468
40 % 2 161 337
30 % 2 161 355
Entity #30 | Chains: D8,d8
40S ribosomal protein S28-A protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 636
95 % 2 90 423
90 % 2 90 442
70 % 2 191 246
50 % 2 202 229
40 % 2 203 240
30 % 2 203 253
Entity #31 | Chains: D9,d9
40S ribosomal protein S29-A protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 382
95 % 2 72 498
90 % 2 73 522
70 % 2 168 279
50 % 2 177 302
40 % 2 177 311
30 % 2 177 332
Entity #32 | Chains: E0
40S ribosomal protein S30-A protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 371
95 % 2 95 483
90 % 2 107 455
70 % 2 107 482
50 % 2 171 358
40 % 2 171 372
30 % 2 171 387
Entity #33 | Chains: E1,e1
Ubiquitin-40S ribosomal protein S31 protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 39 762
95 % 1 43 938
90 % 1 43 967
70 % 1 78 625
50 % 1 82 625
40 % 1 82 660
30 % 1 82 683
Entity #34 | Chains: SR,sR
Guanine nucleotide-binding protein subunit beta-like protein protein, length: 318 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 71 393
95 % 3 77 449
90 % 3 77 477
70 % 3 77 508
50 % 5 176 278
40 % 5 180 282
30 % 5 183 282
Entity #35 | Chains: SM,sM
Suppressor protein STM1 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1040
95 % 1 27 1358
90 % 1 27 1397
70 % 3 33 1225
50 % 3 33 1268
40 % 3 33 1307
30 % 3 33 1344
Entity #36 | Chains: 1,5
25S ribosomal RNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #37 | Chains: 3,7
5S ribosomal RNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #38 | Chains: 4,8
5.8S ribosomal RNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #39 | Chains: L2,l2
60S ribosomal protein L2-A protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 292
95 % 2 97 387
90 % 2 99 394
70 % 2 173 282
50 % 2 186 277
40 % 47 257 201
30 % 47 257 213
Entity #4 | Chains: S2,s2
40S ribosomal protein S2 protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 51 583
95 % 2 51 784
90 % 2 51 818
70 % 2 59 762
50 % 2 66 731
40 % 2 66 756
30 % 2 66 805
Entity #40 | Chains: L3,l3
60S ribosomal protein L3 protein, length: 386 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 282
95 % 2 103 349
90 % 2 105 355
70 % 2 105 395
50 % 2 197 250
40 % 2 197 262
30 % 2 199 273
Entity #41 | Chains: L4,l4
60S ribosomal protein L4-A protein, length: 361 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 264
95 % 2 107 330
90 % 2 107 345
70 % 2 109 382
50 % 2 156 345
40 % 2 197 263
30 % 2 197 279
Entity #42 | Chains: L5,l5
60S ribosomal protein L5 protein, length: 296 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 93 311
95 % 2 95 398
90 % 2 95 414
70 % 2 97 437
50 % 2 182 292
40 % 2 184 293
30 % 2 184 316
Entity #43 | Chains: L6,l6
60S ribosomal protein L6-A protein, length: 175 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 289
95 % 2 102 355
90 % 2 103 367
70 % 2 106 388
50 % 2 107 445
40 % 2 111 456
30 % 2 111 476
Entity #44 | Chains: L7,l7
60S ribosomal protein L7-A protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 261
95 % 2 103 348
90 % 2 103 369
70 % 2 105 394
50 % 2 184 284
40 % 2 184 298
30 % 2 183 327
Entity #45 | Chains: L8,l8
60S ribosomal protein L8-A protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 317
95 % 2 106 350
90 % 2 106 368
70 % 2 108 391
50 % 2 168 327
40 % 2 170 336
30 % 2 170 353
Entity #46 | Chains: L9,l9
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 268
95 % 2 102 354
90 % 2 102 375
70 % 2 104 399
50 % 2 192 268
40 % 2 193 273
30 % 47 265 205
Entity #47 | Chains: M0,m0
60S ribosomal protein L10 protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 83 341
95 % 2 83 446
90 % 2 85 467
70 % 2 85 496
50 % 2 175 311
40 % 2 175 323
30 % 2 175 341
Entity #48 | Chains: M1,m1
60S ribosomal protein L11-B protein, length: 173 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 23 1127
95 % 2 98 383
90 % 2 100 388
70 % 3 185 261
50 % 3 189 269
40 % 3 189 283
30 % 3 189 303
Entity #49 | Chains: M3,m3
60S ribosomal protein L13-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 278
95 % 2 101 370
90 % 2 101 387
70 % 2 103 409
50 % 2 103 463
40 % 2 182 306
30 % 2 182 329
Entity #5 | Chains: S3,s3
40S ribosomal protein S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 72 385
95 % 3 72 499
90 % 3 72 527
70 % 3 84 497
50 % 3 168 322
40 % 3 168 334
30 % 3 168 349
Entity #50 | Chains: M4,m4
60S ribosomal protein L14-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 260
95 % 2 103 346
90 % 2 103 366
70 % 2 105 390
50 % 2 105 453
40 % 2 105 481
30 % 2 105 500
Entity #51 | Chains: M5,m5
60S ribosomal protein L15-A protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 258
95 % 2 108 327
90 % 2 108 343
70 % 2 182 266
50 % 2 196 255
40 % 2 196 268
30 % 2 196 285
Entity #52 | Chains: M6,m6
60S ribosomal protein L16-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 302
95 % 2 95 399
90 % 2 102 374
70 % 2 104 398
50 % 2 184 282
40 % 2 185 292
30 % 2 185 312
Entity #53 | Chains: M7,m7
60S ribosomal protein L17-A protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 251
95 % 2 106 333
90 % 2 108 341
70 % 2 108 385
50 % 2 194 260
40 % 2 194 271
30 % 2 194 287
Entity #54 | Chains: M8,m8
60S ribosomal protein L18-A protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 265
95 % 2 103 352
90 % 2 105 356
70 % 2 105 397
50 % 2 185 293
40 % 2 190 289
30 % 2 190 306
Entity #55 | Chains: M9,m9
60S ribosomal protein L19-A protein, length: 188 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 287
95 % 2 97 384
90 % 2 97 404
70 % 2 100 414
50 % 2 184 285
40 % 2 185 297
30 % 2 185 321
Entity #56 | Chains: N0,n0
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 275
95 % 2 101 368
90 % 2 103 372
70 % 2 103 407
50 % 2 175 317
40 % 2 176 321
30 % 2 177 335
Entity #57 | Chains: N1,n1
60S ribosomal protein L21-A protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 288
95 % 2 97 386
90 % 2 99 390
70 % 2 99 418
50 % 2 174 320
40 % 2 180 316
30 % 2 187 308
Entity #58 | Chains: N2,n2
60S ribosomal protein L22-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 460
95 % 2 72 599
90 % 2 72 627
70 % 2 73 647
50 % 2 73 683
40 % 2 73 713
30 % 2 74 716
Entity #59 | Chains: N3,n3
60S ribosomal protein L23-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 257
95 % 2 104 345
90 % 2 106 349
70 % 2 196 239
50 % 47 267 178
40 % 47 267 191
30 % 47 267 204
Entity #6 | Chains: S4,s4
40S ribosomal protein S4-A protein, length: 260 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 367
95 % 2 77 477
90 % 2 89 449
70 % 2 181 260
50 % 2 191 252
40 % 2 195 258
30 % 2 204 254
Entity #60 | Chains: N4,n4
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 64 482
95 % 2 66 629
90 % 2 66 653
70 % 2 67 686
50 % 2 67 722
40 % 2 114 486
30 % 2 114 509
Entity #61 | Chains: N5,n5
60S ribosomal protein L25 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 428
95 % 2 77 552
90 % 2 78 573
70 % 2 78 601
50 % 2 78 628
40 % 2 80 649
30 % 2 81 667
Entity #62 | Chains: N6,n6
60S ribosomal protein L26-A protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 108 247
95 % 2 108 324
90 % 2 110 332
70 % 2 110 378
50 % 2 192 266
40 % 2 192 280
30 % 2 192 296
Entity #63 | Chains: N7,n7
60S ribosomal protein L27-A protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 296
95 % 2 97 391
90 % 2 99 398
70 % 2 99 433
50 % 2 170 326
40 % 2 183 303
30 % 2 185 319
Entity #64 | Chains: N8,n8
60S ribosomal protein L28 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 307
95 % 2 98 379
90 % 2 100 385
70 % 2 100 413
50 % 2 187 274
40 % 2 188 285
30 % 2 190 299
Entity #65 | Chains: N9,n9
60S ribosomal protein L29 protein, length: 58 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 89 326
95 % 2 89 429
90 % 2 91 441
70 % 2 91 466
50 % 2 91 505
40 % 2 91 541
30 % 2 91 567
Entity #66 | Chains: O0,o0
60S ribosomal protein L30 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 103 255
95 % 3 103 339
90 % 3 105 348
70 % 3 105 386
50 % 3 145 363
40 % 3 145 377
30 % 3 145 391
Entity #67 | Chains: O1,o1
60S ribosomal protein L31-A protein, length: 112 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 270
95 % 2 101 363
90 % 2 101 382
70 % 2 103 403
50 % 2 184 283
40 % 2 184 296
30 % 2 184 320
Entity #68 | Chains: O2,o2
60S ribosomal protein L32 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 259
95 % 2 104 344
90 % 2 104 363
70 % 2 106 389
50 % 2 188 271
40 % 2 192 278
30 % 2 193 290
Entity #69 | Chains: O3,o3
60S ribosomal protein L33-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 271
95 % 2 102 360
90 % 2 102 379
70 % 2 104 402
50 % 2 180 308
40 % 2 182 312
30 % 2 182 333
Entity #7 | Chains: S5,s5
40S ribosomal protein S5 protein, length: 224 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 356
95 % 2 79 459
90 % 2 91 431
70 % 2 91 462
50 % 2 201 232
40 % 2 201 244
30 % 2 201 258
Entity #70 | Chains: O4,o4
60S ribosomal protein L34-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 295
95 % 2 97 396
90 % 2 97 408
70 % 2 99 432
50 % 2 169 329
40 % 2 169 341
30 % 2 169 360
Entity #71 | Chains: O5,o5
60S ribosomal protein L35-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 248
95 % 2 107 328
90 % 2 107 344
70 % 2 109 380
50 % 2 187 279
40 % 2 198 261
30 % 2 200 270
Entity #72 | Chains: O6,o6
60S ribosomal protein L36-A protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 293
95 % 2 102 364
90 % 2 102 384
70 % 2 104 406
50 % 2 104 459
40 % 2 177 318
30 % 2 177 339
Entity #73 | Chains: O7,o7
60S ribosomal protein L37-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 256
95 % 2 104 342
90 % 2 104 360
70 % 2 148 307
50 % 2 192 265
40 % 2 192 279
30 % 2 192 295
Entity #74 | Chains: O8,o8
60S ribosomal protein L38 protein, length: 77 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 298
95 % 2 97 395
90 % 2 97 409
70 % 2 99 430
50 % 2 99 481
40 % 2 106 469
30 % 2 106 493
Entity #75 | Chains: O9,o9
60S ribosomal protein L39 protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 272
95 % 2 101 358
90 % 2 101 378
70 % 2 176 277
50 % 2 188 273
40 % 2 190 281
30 % 2 191 297
Entity #76 | Chains: Q0,q0
Ubiquitin-60S ribosomal protein L40 protein, length: 52 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 49 545
95 % 1 50 735
90 % 1 50 764
70 % 1 95 471
50 % 1 95 510
40 % 1 95 546
30 % 1 95 571
Entity #77 | Chains: Q1,q1
60S ribosomal protein L41-A protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 81 343
95 % 2 81 456
90 % 2 81 484
70 % 2 162 285
50 % 2 162 335
40 % 2 162 348
30 % 2 162 365
Entity #78 | Chains: Q2,q2
60S ribosomal protein L42-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 305
95 % 2 94 406
90 % 2 96 412
70 % 2 173 281
50 % 2 180 300
40 % 2 181 308
30 % 2 181 330
Entity #79 | Chains: Q3,q3
60S ribosomal protein L43-A protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 306
95 % 2 94 403
90 % 2 94 419
70 % 2 96 441
50 % 2 183 286
40 % 2 184 294
30 % 23 207 257
Entity #8 | Chains: S6,s6
40S ribosomal protein S6-A protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 375
95 % 2 77 482
90 % 2 77 509
70 % 2 89 480
50 % 2 182 294
40 % 2 187 288
30 % 2 187 307
Entity #80 | Chains: e0
40S ribosomal protein S30-A protein, length: 62 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 95 371
95 % 3 95 483
90 % 3 107 455
70 % 3 107 482
50 % 3 171 358
40 % 3 171 372
30 % 3 171 387
Entity #81 | Chains: m2
Unknown protein m2 protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #82 | Chains: p0
60S acidic ribosomal protein P0 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 40701
95 % 1 43 1531
90 % 2 47 1433
70 % 2 48 1435
50 % 2 69 1004
40 % 2 69 1036
30 % 2 69 1079
Entity #83 | Chains: p1
Unknown protein p1 protein, length: 47 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #84 | Chains: p2
Unknown protein p2 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #9 | Chains: S7,s7
40S ribosomal protein S7-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 369
95 % 2 76 478
90 % 2 88 456
70 % 2 88 485
50 % 2 188 270
40 % 2 188 284
30 % 2 191 283


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 12 AK, CK 40S ribosomal protein S10-A 4932
2 4U4R 12 C0, c0 40S ribosomal protein S10-A 4932
3 4U3U 12 C0, c0 40S ribosomal protein S10-A 4932
4 5TBW 59 L, c0 40S ribosomal protein S10-A 4932
5 4U3M 12 C0, c0 40S ribosomal protein S10-B 4932
6 4U3N 12 C0 40S ribosomal protein S10-A 4932
7 4U3N 80 c0 40S ribosomal protein S10-A 4932
8 4U52 12 C0, c0 40S ribosomal protein S10-A 4932
9 4U4Q 12 C0, c0 40S ribosomal protein S10-A 4932
10 4U6F 12 C0, c0 40S ribosomal protein S10-A 4932
11 4U4U 12 C0, c0 40S ribosomal protein S10-A 4932
12 4U4Z 12 C0, c0 40S ribosomal protein S10-A 4932
13 4U4Y 12 C0, c0 40S ribosomal protein S10-A 4932
14 4U4N 12 C0, c0 40S ribosomal protein S10-A 4932
15 4U55 12 C0, c0 40S ribosomal protein S10-A 4932
16 5DAT 12 C0, c0 40S ribosomal protein S10-A 4932
17 5I4L 12 C0, c0 40S ribosomal protein S10-A 4932
18 4U51 12 C0, c0 40S ribosomal protein S10-A 4932
19 6HHQ 58 L, c0 40S ribosomal protein S10-A 4932
20 5OBM 56 C0, c0 40S ribosomal protein S10-A 4932
21 4U53 12 C0, c0 40S ribosomal protein S10-A 4932
22 5ON6 60 L, c0 40S ribosomal protein S10-A 4932
23 4U50 12 C0, c0 40S ribosomal protein S10-A 4932
24 5NDV 56 C0, c0 40S ribosomal protein S10-A 4932
25 5LYB 12 C0 40S ribosomal protein S10-A,40S ribosomal protein S10-A,40S Ribosomal Protein S10-A 4932
26 5LYB 80 c0 40S ribosomal protein S10-A,40S ribosomal protein S10-A,40S Ribosomal Protein S10 4932
27 4U56 12 C0, c0 40S ribosomal protein S10-A 4932
28 5TGA 12 C0 40S ribosomal protein S10-A 4932
29 5TGA 81 c0 40S ribosomal protein S10-A,40S ribosomal protein S10-A,40S Ribosomal Protein S10-A 4932
30 5MEI 59 L, c0 40S ribosomal protein S10-A 4932
31 5FCJ 12 C0, c0 40S ribosomal protein S10-A,40S ribosomal protein S10-A,40S ribosomal protein S10-A,40S ribosomal protein S10-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYL NLPEHIVPATYIQERNPTQRPQRRY 4932
32 4U4O 12 C0, c0 40S ribosomal protein S10-A 4932
33 5DGV 12 C0, c0 40S ribosomal protein S10-A 4932
34 5DGE 12 C0, c0 40S ribosomal protein S10-A 4932
35 5NDW 5 C0, c0 40S ribosomal protein S10-A 4932
36 5NDG 12 C0, c0 40S ribosomal protein S10-A 4932
37 5FCI 12 C0 40S ribosomal protein S10-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYL NLPEHIVPATYIQERNPTQRPQRRY 4932
38 5FCI 80 c0 40S ribosomal protein S10-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYL NLPEHIVPATYIQERNPTQRPQRRY 4932
39 5DC3 12 C0 40S ribosomal protein S10-A 4932
40 5DC3 80 c0 40S ribosomal protein S10-A 4932
41 5DGF 12 C0, c0 40S ribosomal protein S10-A 4932
42 5TGM 12 C0 40S ribosomal protein S10-A,40S Ribosomal Protein S10 4932
43 5TGM 81 c0 40S ribosomal protein S10-A,40S Ribosomal Protein S10 4932
44 6TNU 14 C 40S ribosomal protein S10-A 4932
45 6UZ7 58 K KLLA0B08173p 28985
46 6TB3 14 C 40S ribosomal protein S10-A 4932
47 6T83 13 Kb, l 40S ribosomal protein S10-A 4932
48 6T7T 15 SK 40S ribosomal protein S10-A 4932
49 6T7I 13 SK 40S ribosomal protein S10-A 4932
50 6T4Q 12 SK 40S ribosomal protein S10-A 4932
51 6SV4 29 C, Cb, Cc 40S ribosomal protein S10-A 4932
52 6SNT 13 K 40S ribosomal protein S10-A 4932
53 6S47 56 BL 40S ribosomal protein S10-A 4932
54 6RBE 23 K 40S ribosomal protein S10-A 4932
55 6Q8Y 59 C 40S ribosomal protein S10-A 4932
56 6I7O 29 C, Cb 40S ribosomal protein S10-A 4932
57 6GSM 14 K KLLA0B08173p 28985
58 6GSN 5 K KLLA0B08173p 28985
59 6GQV 58 AA 40S ribosomal protein S10-A 4932
60 6GQ1 58 AA 40S ribosomal protein S10-A 4932
61 6GQB 58 AA 40S ribosomal protein S10-A 4932
62 6FYX 14 K KLLA0B08173p 28985
63 6FYY 14 K KLLA0B08173p 28985
64 5MC6 4 C 40S ribosomal protein S10-A 4932
65 5M1J 18 K2 40S ribosomal protein S10-A 4932
66 5JUO 60 HB eS10 (yeast S10) 4932
67 5JUP 60 HB eS10 (yeast S10) 4932
68 5JUS 60 HB eS10 (yeast S10) 4932
69 5JUT 60 HB eS10 (yeast S10) 4932
70 5JUU 60 HB eS10 (yeast S10) 4932
71 5IT7 58 K KLLA0B08173p 28985
72 5IT9 11 K Ribosomal protein eS10 28985
73 3JAP 14 K eS10 28985
74 3JAQ 14 K eS10 28985
75 3JAM 12 K eS10 28985
76 4UER 8 7 ES10 4934
77 3J81 12 K eS10 28985
78 3J80 22 K eS10 28985
79 3J77 56 10 40S ribosomal protein S10 4932
80 3J78 56 10 40S ribosomal protein S10 4932
81 3J6X 57 10 40S ribosomal protein S10 4932
82 3J6Y 57 10 40S ribosomal protein S10 4932
83 4V8Y 19 AK 40S RIBOSOMAL PROTEIN S10-A 4932
84 4V8Z 19 AK 40S RIBOSOMAL PROTEIN S10-A 4932