4U4R

Crystal structure of Lactimidomycin bound to the yeast 80S ribosome


Sequence Similarity Clusters for the Entities in PDB 4U4R

Entity #1 | Chains: 2,6
18S ribosomal RNA rna, length: 1800 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: S8,s8
40S ribosomal protein S8-A protein, length: 200 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 412
95 % 2 70 528
90 % 2 76 510
70 % 2 93 460
50 % 2 190 260
40 % 2 194 260
30 % 2 194 272
Entity #11 | Chains: S9,s9
40S ribosomal protein S9-A protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 350
95 % 2 80 459
90 % 2 92 428
70 % 2 185 250
50 % 2 200 236
40 % 2 208 236
30 % 2 208 246
Entity #12 | Chains: C0,c0
40S ribosomal protein S10-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 19 1547
95 % 2 65 614
90 % 2 68 624
70 % 2 84 537
50 % 2 84 564
40 % 2 84 604
30 % 2 84 621
Entity #13 | Chains: C1,c1
40S ribosomal protein S11-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 358
95 % 2 78 471
90 % 2 90 438
70 % 2 95 449
50 % 2 197 244
40 % 2 197 253
30 % 2 197 264
Entity #14 | Chains: C2,c2
40S ribosomal protein S12 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 33 1147
95 % 2 51 774
90 % 2 53 771
70 % 2 85 506
50 % 2 85 533
40 % 2 88 559
30 % 2 88 581
Entity #15 | Chains: C3,c3
40S ribosomal protein S13 protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 362
95 % 2 78 472
90 % 2 90 441
70 % 2 190 248
50 % 2 197 246
40 % 2 205 239
30 % 2 206 248
Entity #16 | Chains: C4,c4
40S ribosomal protein S14-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 349
95 % 2 92 413
90 % 2 92 427
70 % 2 198 227
50 % 2 199 238
40 % 2 199 247
30 % 2 199 259
Entity #17 | Chains: C5,c5
40S ribosomal protein S15 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 58 533
95 % 2 68 548
90 % 2 68 576
70 % 2 86 499
50 % 2 179 302
40 % 2 187 286
30 % 2 187 304
Entity #18 | Chains: C6,c6
40S ribosomal protein S16-A protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 348
95 % 2 91 416
90 % 2 92 430
70 % 2 92 461
50 % 2 190 253
40 % 2 198 249
30 % 2 199 260
Entity #19 | Chains: C7,c7
40S ribosomal protein S17-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 415
95 % 2 70 531
90 % 2 82 491
70 % 2 82 518
50 % 2 176 304
40 % 2 176 310
30 % 2 176 327
Entity #2 | Chains: S0,s0
40S ribosomal protein S0-A protein, length: 251 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 606
95 % 2 51 787
90 % 2 51 820
70 % 2 59 759
50 % 2 68 715
40 % 2 133 403
30 % 2 133 414
Entity #20 | Chains: C8,c8
40S ribosomal protein S18-A protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 371
95 % 2 76 479
90 % 2 88 452
70 % 2 183 254
50 % 2 192 252
40 % 2 202 242
30 % 2 202 255
Entity #21 | Chains: C9,c9
40S ribosomal protein S19-A protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 74 375
95 % 2 74 488
90 % 2 74 515
70 % 2 86 492
50 % 2 87 519
40 % 2 87 554
30 % 2 88 574
Entity #22 | Chains: D0,d0
40S ribosomal protein S20 protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 381
95 % 2 74 494
90 % 2 74 523
70 % 2 86 496
50 % 2 86 525
40 % 2 88 537
30 % 2 88 564
Entity #23 | Chains: D1,d1
40S ribosomal protein S21-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 386
95 % 2 73 501
90 % 2 85 473
70 % 2 85 501
50 % 2 171 317
40 % 2 171 327
30 % 2 171 341
Entity #24 | Chains: D2,d2
40S ribosomal protein S22-A protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 364
95 % 2 94 411
90 % 2 94 425
70 % 2 201 234
50 % 2 203 231
40 % 3 212 230
30 % 38 808 23
Entity #25 | Chains: D3,d3
40S ribosomal protein S23-A protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 366
95 % 2 90 421
90 % 2 90 435
70 % 2 204 222
50 % 2 214 221
40 % 2 214 227
30 % 2 214 235
Entity #26 | Chains: D4,d4
40S ribosomal protein S24-A protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 365
95 % 2 78 476
90 % 2 90 446
70 % 2 90 474
50 % 2 192 267
40 % 2 192 280
30 % 2 192 292
Entity #27 | Chains: D5,d5
40S ribosomal protein S25-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 50 590
95 % 2 50 796
90 % 2 50 831
70 % 2 58 775
50 % 2 58 807
40 % 2 58 837
30 % 2 60 857
Entity #28 | Chains: D6,d6
40S ribosomal protein S26-B protein, length: 97 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 47 570
95 % 1 47 762
90 % 1 51 757
70 % 1 51 779
50 % 1 85 552
40 % 1 85 591
30 % 1 85 608
Entity #29 | Chains: D7,d7
40S ribosomal protein S27-A protein, length: 81 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 378
95 % 2 87 441
90 % 2 87 468
70 % 2 175 270
50 % 2 187 268
40 % 2 187 281
30 % 2 187 295
Entity #3 | Chains: S1,s1
40S ribosomal protein S1-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 384
95 % 2 74 499
90 % 2 84 478
70 % 2 91 470
50 % 2 97 470
40 % 2 161 336
30 % 2 161 355
Entity #30 | Chains: D8,d8
40S ribosomal protein S28-A protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 632
95 % 2 90 419
90 % 2 90 436
70 % 2 191 247
50 % 2 202 232
40 % 2 203 241
30 % 2 203 252
Entity #31 | Chains: D9,d9
40S ribosomal protein S29-A protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 383
95 % 2 72 504
90 % 2 73 528
70 % 2 168 281
50 % 2 176 294
40 % 2 176 305
30 % 2 176 325
Entity #32 | Chains: E0
40S ribosomal protein S30-A protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 370
95 % 2 95 481
90 % 2 107 456
70 % 2 107 484
50 % 2 171 360
40 % 2 171 371
30 % 2 171 385
Entity #33 | Chains: E1,e1
Ubiquitin-40S ribosomal protein S31 protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 39 774
95 % 1 43 949
90 % 1 43 982
70 % 1 78 627
50 % 1 82 628
40 % 1 82 667
30 % 1 82 685
Entity #34 | Chains: SR,sR
Guanine nucleotide-binding protein subunit beta-like protein protein, length: 318 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 71 394
95 % 3 77 452
90 % 3 77 481
70 % 3 77 508
50 % 5 176 280
40 % 5 182 271
30 % 5 183 283
Entity #35 | Chains: SM,sM
Suppressor protein STM1 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1033
95 % 1 27 1370
90 % 1 27 1410
70 % 3 33 1227
50 % 3 33 1278
40 % 3 33 1315
30 % 3 33 1349
Entity #36 | Chains: 1,5
25S ribosomal RNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #37 | Chains: 3,7
5S ribosomal RNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #38 | Chains: 4,8
5.8S ribosomal RNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #39 | Chains: L2,l2
60S ribosomal protein L2-A protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 292
95 % 2 97 392
90 % 2 99 397
70 % 2 174 278
50 % 2 187 277
40 % 47 258 200
30 % 47 258 210
Entity #4 | Chains: S2,s2
40S ribosomal protein S2 protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 51 581
95 % 2 51 785
90 % 2 51 819
70 % 2 59 761
50 % 2 66 732
40 % 2 66 760
30 % 2 66 800
Entity #40 | Chains: L3,l3
60S ribosomal protein L3 protein, length: 386 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 288
95 % 2 103 355
90 % 2 105 362
70 % 2 105 402
50 % 2 198 250
40 % 2 198 262
30 % 2 200 269
Entity #41 | Chains: L4,l4
60S ribosomal protein L4-A protein, length: 361 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 270
95 % 2 107 329
90 % 2 107 346
70 % 2 109 385
50 % 2 157 345
40 % 2 198 263
30 % 2 198 275
Entity #42 | Chains: L5,l5
60S ribosomal protein L5 protein, length: 296 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 93 316
95 % 2 95 405
90 % 2 95 421
70 % 2 97 442
50 % 2 183 290
40 % 2 185 292
30 % 2 185 311
Entity #43 | Chains: L6,l6
60S ribosomal protein L6-A protein, length: 175 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 298
95 % 2 102 356
90 % 2 103 369
70 % 2 106 393
50 % 2 107 444
40 % 2 111 456
30 % 2 111 474
Entity #44 | Chains: L7,l7
60S ribosomal protein L7-A protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 267
95 % 2 103 352
90 % 2 103 371
70 % 2 105 398
50 % 2 185 284
40 % 2 185 295
30 % 2 184 319
Entity #45 | Chains: L8,l8
60S ribosomal protein L8-A protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 319
95 % 2 106 350
90 % 2 106 375
70 % 2 108 397
50 % 2 169 328
40 % 2 171 333
30 % 2 171 350
Entity #46 | Chains: L9,l9
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 272
95 % 2 102 357
90 % 2 102 378
70 % 2 104 405
50 % 2 193 270
40 % 47 265 193
30 % 47 266 203
Entity #47 | Chains: M0,m0
60S ribosomal protein L10 protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 83 341
95 % 2 83 449
90 % 2 85 470
70 % 2 85 498
50 % 2 176 310
40 % 2 176 319
30 % 2 176 334
Entity #48 | Chains: M1,m1
60S ribosomal protein L11-B protein, length: 173 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 23 1157
95 % 2 98 385
90 % 2 100 392
70 % 3 186 257
50 % 3 190 271
40 % 3 190 283
30 % 3 190 298
Entity #49 | Chains: M3,m3
60S ribosomal protein L13-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 280
95 % 2 101 372
90 % 2 101 390
70 % 2 103 412
50 % 2 103 462
40 % 2 183 303
30 % 2 183 324
Entity #5 | Chains: S3,s3
40S ribosomal protein S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 72 387
95 % 3 72 505
90 % 3 72 534
70 % 3 84 503
50 % 3 168 323
40 % 3 168 332
30 % 3 168 349
Entity #50 | Chains: M4,m4
60S ribosomal protein L14-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 268
95 % 2 103 354
90 % 2 103 372
70 % 2 105 399
50 % 2 105 456
40 % 2 105 484
30 % 2 105 501
Entity #51 | Chains: M5,m5
60S ribosomal protein L15-A protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 262
95 % 2 108 328
90 % 2 108 345
70 % 2 183 265
50 % 2 197 256
40 % 2 197 267
30 % 2 197 281
Entity #52 | Chains: M6,m6
60S ribosomal protein L16-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 305
95 % 2 95 402
90 % 2 102 377
70 % 2 104 404
50 % 2 185 281
40 % 2 186 291
30 % 2 186 309
Entity #53 | Chains: M7,m7
60S ribosomal protein L17-A protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 256
95 % 2 106 334
90 % 2 108 340
70 % 2 108 389
50 % 2 195 259
40 % 2 195 272
30 % 2 195 285
Entity #54 | Chains: M8,m8
60S ribosomal protein L18-A protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 266
95 % 2 103 349
90 % 2 105 355
70 % 2 105 396
50 % 2 186 289
40 % 2 191 287
30 % 2 191 305
Entity #55 | Chains: M9,m9
60S ribosomal protein L19-A protein, length: 188 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 293
95 % 2 97 391
90 % 2 97 408
70 % 2 100 419
50 % 2 185 286
40 % 2 186 297
30 % 2 186 312
Entity #56 | Chains: N0,n0
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 283
95 % 2 101 377
90 % 2 103 382
70 % 2 103 414
50 % 2 176 319
40 % 2 177 320
30 % 2 178 332
Entity #57 | Chains: N1,n1
60S ribosomal protein L21-A protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 295
95 % 2 97 389
90 % 2 99 398
70 % 2 99 423
50 % 2 175 318
40 % 2 181 315
30 % 2 188 303
Entity #58 | Chains: N2,n2
60S ribosomal protein L22-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 456
95 % 2 72 597
90 % 2 72 629
70 % 2 73 650
50 % 2 73 683
40 % 2 73 715
30 % 2 74 717
Entity #59 | Chains: N3,n3
60S ribosomal protein L23-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 263
95 % 2 104 346
90 % 2 106 353
70 % 2 197 240
50 % 2 198 251
40 % 2 198 264
30 % 2 198 274
Entity #6 | Chains: S4,s4
40S ribosomal protein S4-A protein, length: 260 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 368
95 % 2 77 480
90 % 2 89 455
70 % 2 181 261
50 % 2 191 255
40 % 2 195 258
30 % 2 204 254
Entity #60 | Chains: N4,n4
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 64 477
95 % 2 66 627
90 % 2 66 654
70 % 2 67 680
50 % 2 67 720
40 % 2 114 489
30 % 2 114 511
Entity #61 | Chains: N5,n5
60S ribosomal protein L25 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 425
95 % 2 77 556
90 % 2 78 573
70 % 2 78 599
50 % 2 78 638
40 % 2 80 655
30 % 2 81 669
Entity #62 | Chains: N6,n6
60S ribosomal protein L26-A protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 108 249
95 % 2 108 324
90 % 2 110 335
70 % 2 110 381
50 % 2 193 266
40 % 2 193 278
30 % 2 193 291
Entity #63 | Chains: N7,n7
60S ribosomal protein L27-A protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 302
95 % 2 97 397
90 % 2 99 403
70 % 2 99 435
50 % 2 171 326
40 % 2 184 298
30 % 2 186 314
Entity #64 | Chains: N8,n8
60S ribosomal protein L28 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 309
95 % 2 98 387
90 % 2 100 393
70 % 2 100 418
50 % 2 188 275
40 % 2 189 284
30 % 2 191 296
Entity #65 | Chains: N9,n9
60S ribosomal protein L29 protein, length: 58 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 89 329
95 % 2 89 432
90 % 2 91 440
70 % 2 91 466
50 % 2 91 505
40 % 2 91 540
30 % 2 91 566
Entity #66 | Chains: O0,o0
60S ribosomal protein L30 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 103 261
95 % 3 103 341
90 % 3 105 351
70 % 3 105 392
50 % 3 146 363
40 % 3 146 374
30 % 3 146 388
Entity #67 | Chains: O1,o1
60S ribosomal protein L31-A protein, length: 112 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 276
95 % 2 101 364
90 % 2 101 385
70 % 2 103 410
50 % 2 185 283
40 % 2 185 296
30 % 2 185 316
Entity #68 | Chains: O2,o2
60S ribosomal protein L32 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 265
95 % 2 104 348
90 % 2 104 368
70 % 2 106 395
50 % 2 189 274
40 % 2 193 279
30 % 2 194 287
Entity #69 | Chains: O3,o3
60S ribosomal protein L33-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 274
95 % 2 102 362
90 % 2 102 383
70 % 2 104 408
50 % 2 181 308
40 % 2 183 311
30 % 2 183 328
Entity #7 | Chains: S5,s5
40S ribosomal protein S5 protein, length: 224 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 361
95 % 2 79 462
90 % 2 91 432
70 % 2 91 462
50 % 2 201 234
40 % 2 201 244
30 % 2 201 258
Entity #70 | Chains: O4,o4
60S ribosomal protein L34-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 300
95 % 2 97 400
90 % 2 97 412
70 % 2 99 430
50 % 2 170 329
40 % 2 170 335
30 % 2 170 354
Entity #71 | Chains: O5,o5
60S ribosomal protein L35-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 253
95 % 2 107 330
90 % 2 107 347
70 % 2 109 387
50 % 2 188 282
40 % 2 199 261
30 % 2 201 268
Entity #72 | Chains: O6,o6
60S ribosomal protein L36-A protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 294
95 % 2 102 365
90 % 2 102 386
70 % 2 104 411
50 % 2 104 461
40 % 2 178 316
30 % 2 178 331
Entity #73 | Chains: O7,o7
60S ribosomal protein L37-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 264
95 % 2 104 343
90 % 2 104 366
70 % 2 148 306
50 % 2 193 264
40 % 2 193 276
30 % 2 193 289
Entity #74 | Chains: O8,o8
60S ribosomal protein L38 protein, length: 77 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 303
95 % 2 97 401
90 % 2 97 416
70 % 2 99 437
50 % 2 99 484
40 % 2 106 472
30 % 2 106 493
Entity #75 | Chains: O9,o9
60S ribosomal protein L39 protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 278
95 % 2 101 363
90 % 2 101 384
70 % 2 176 276
50 % 2 189 273
40 % 2 191 282
30 % 2 192 294
Entity #76 | Chains: Q0,q0
Ubiquitin-60S ribosomal protein L40 protein, length: 52 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 49 543
95 % 1 50 730
90 % 1 50 766
70 % 1 96 467
50 % 1 96 506
40 % 1 96 541
30 % 1 96 567
Entity #77 | Chains: Q1,q1
60S ribosomal protein L41-A protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 81 346
95 % 2 81 460
90 % 2 81 490
70 % 2 163 284
50 % 2 163 334
40 % 2 163 344
30 % 2 163 361
Entity #78 | Chains: Q2,q2
60S ribosomal protein L42-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 307
95 % 2 94 408
90 % 2 96 410
70 % 2 174 279
50 % 2 181 298
40 % 2 182 306
30 % 2 182 326
Entity #79 | Chains: Q3,q3
60S ribosomal protein L43-A protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 308
95 % 2 94 406
90 % 2 94 422
70 % 2 96 444
50 % 2 184 285
40 % 2 185 293
30 % 23 208 256
Entity #8 | Chains: S6,s6
40S ribosomal protein S6-A protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 374
95 % 2 77 485
90 % 2 77 509
70 % 2 89 489
50 % 2 182 296
40 % 2 187 289
30 % 2 187 306
Entity #80 | Chains: e0
40S ribosomal protein S30-A protein, length: 62 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 95 370
95 % 3 95 481
90 % 3 107 456
70 % 3 107 484
50 % 3 171 360
40 % 3 171 371
30 % 3 171 385
Entity #81 | Chains: m2
Unknown protein m2 protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #82 | Chains: p0
60S acidic ribosomal protein P0 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 54937
95 % 1 43 1535
90 % 2 47 1454
70 % 2 48 1448
50 % 2 69 1016
40 % 2 69 1043
30 % 2 69 1093
Entity #83 | Chains: p1
Unknown protein p1 protein, length: 47 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #84 | Chains: p2
Unknown protein p2 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #9 | Chains: S7,s7
40S ribosomal protein S7-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 372
95 % 2 76 483
90 % 2 88 460
70 % 2 88 485
50 % 2 188 272
40 % 2 188 285
30 % 2 191 282

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 4BTS 27 AQ, BQ, CQ, DQ 40S RIBOSOMAL PROTEIN RPS11E 5911
34 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
35 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
36 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
37 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
38 4V5O 26 AQ, BQ RIBOSOMAL PROTEIN S17 CONTAINING PROTEIN 5911
39 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
40 4V7R 7 AF, CF 40S ribosomal protein S11 4932
41 5VYC 30 L1, L2, L3, L4, L5, L6 40S ribosomal protein S11 9606
42 4KZZ 12 L 40S Ribosomal Protein S11 9986
43 4KZX 12 L 40S ribosomal protein S11 9986
44 4KZY 12 L 40S Ribosomal Protein S11 9986
45 6YAL 14 N 40S ribosomal protein uS17 9986
46 6YAM 14 N 40S ribosomal protein uS17 9986
47 6YAN 13 N Ribosomal protein S11 9986
48 6W2S 11 M uS17 9986
49 6W2T 10 M uS17 9986
50 6Y7C 11 L 40S ribosomal protein S11-A 4932
51 6Y57 61 SL 40S ribosomal protein S11 9606
52 6Y2L 61 SL 40S ribosomal protein S11 9606
53 6Y0G 61 SL 40S ribosomal protein S11 9606
54 6TNU 15 X 40S ribosomal protein S11-A 4932
55 6UZ7 59 L KLLA0A10483p 28985
56 6TB3 15 X 40S ribosomal protein S11-A 4932
57 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
58 6T7T 16 SL 40S ribosomal protein S11-A 4932
59 6T7I 14 SL 40S ribosomal protein S11-A 4932
60 6T4Q 13 SL 40S ribosomal protein S11-A 4932
61 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
62 6SNT 14 L 40S ribosomal protein S11-A 4932
63 6SGC 13 M1 Ribosomal protein S11 9986
64 6S47 57 BM 40S ribosomal protein S11-A 4932
65 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
66 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
67 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
68 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
69 6P5I 13 M uS17 9986
70 6P5J 13 M uS17 9986
71 6P5K 59 M uS17 9986
72 6P5N 59 M uS17 9986
73 6P4G 13 M uS17 9986
74 6P4H 14 M uS17 9986
75 6OM7 10 SL 40S ribosomal protein S11 9606
76 6OLZ 58 BL 40S ribosomal protein S11 9606
77 6OM0 10 SL 40S ribosomal protein S11 9606
78 6OLE 10 SL 40S ribosomal protein S11 9606
79 6OLF 10 SL 40S ribosomal protein S11 9606
80 6OLG 61 BL 40S ribosomal protein S11 9606
81 6OLI 10 SL 40S ribosomal protein S11 9606
82 6OKK 22 V 40S ribosomal protein S11 5833
83 6RBD 12 L 40S ribosomal protein S11-A 4932
84 6RBE 10 L 40S ribosomal protein S11-A 4932
85 6R7Q 5 EE Ribosomal protein S11 9986
86 6R6G 19 EE Ribosomal protein S11 9986
87 6R6P 60 EE Ribosomal protein S11 9986
88 6R5Q 63 EE Ribosomal protein S11 9986
89 6QZP 57 SL 40S ribosomal protein S11 9606
90 6Q8Y 79 X 40S ribosomal protein S11-A 4932
91 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
92 6IP5 56 2v 40S ribosomal protein S11 9606
93 6IP6 55 2v 40S ribosomal protein S11 9606
94 6IP8 55 2v 40S ribosomal protein S11 9606
95 6MTB 62 LL 40S ribosomal protein S11 9986
96 6MTC 61 LL 40S ribosomal protein S11 9986
97 6MTD 63 LL uS17 9986
98 6MTE 62 LL uS17 9986
99 6HCQ 16 M2 Ribosomal protein S11 9986
100 6HCJ 16 M2 Ribosomal protein S11 9986
101 6HCM 13 M1 Ribosomal protein S11 9986
102 6HCF 13 M1 Ribosomal protein S11 9986
103 6GZ3 29 BL Ribosomal protein S11 9986
104 6GZ4 32 BL ribosomal protein uS17 9986
105 6GZ5 29 BL ribosomal protein uS17 9986
106 6GSM 15 L KLLA0A10483p 28985
107 6GSN 36 L KLLA0A10483p 28985
108 6GQV 59 AB 40S ribosomal protein S11-A 4932
109 6GQ1 59 AB 40S ribosomal protein S11-A 4932
110 6GQB 59 AB 40S ribosomal protein S11-A 4932
111 6D9J 61 MM uS17 9986
112 6D90 62 MM uS17 9986
113 6G5H 10 L 40S ribosomal protein S11 9606
114 6G5I 13 L 40S ribosomal protein S11 9606
115 6G4S 29 L 40S ribosomal protein S11 9606
116 6G4W 25 L 40S ribosomal protein S11 9606
117 6G51 11 L 40S ribosomal protein S11 9606
118 6G53 11 L 40S ribosomal protein S11 9606
119 6G18 21 L 40S ribosomal protein S11 9606
120 6FYX 15 L KLLA0A10483p 28985
121 6FYY 15 L KLLA0A10483p 28985
122 6FEC 12 G 40S ribosomal protein S11 9606
123 6FAI 22 L 40S ribosomal protein S11-A 4932
124 6EML 20 X 40S ribosomal protein S11-A 4932
125 6EK0 57 SL 40S ribosomal protein S11 9606
126 6AZ1 21 U ribosomal protein S17 5661
127 5OQL 44 v 40S ribosomal protein S11-like protein 209285
128 5OPT 16 X 40S ribosomal protein S11, putative 5693
129 5WLC 12 LD rpS11_uS17 4932
130 5XYI 13 L Uncharacterized protein 5722
131 5XXU 13 L Ribosomal protein uS17 5811
132 5OA3 16 L 40S ribosomal protein S11 9606
133 5WYJ 42 SM 40S ribosomal protein S11-A 4932
134 5WYK 39 SM 40S ribosomal protein S11-A 4932
135 5TZS 13 D rpS11_uS17 4932
136 5MC6 25 X 40S ribosomal protein S11-A 4932
137 5M1J 19 L2 40S ribosomal protein S11-A 4932
138 5LZS 62 LL uS17 9986
139 5LZT 63 LL uS17 9986
140 5LZU 62 LL uS17 9986
141 5LZV 63 LL uS17 9986
142 5LZW 63 LL uS17 9986
143 5LZX 63 LL uS17 9986
144 5LZY 61 LL uS17 9986
145 5LZZ 63 LL uS17 9986
146 5T2A 61 AE uS17 5661
147 5T2C 73 Aw 40S ribosomal protein S11 9606
148 5LL6 10 X 40S ribosomal protein S11-A 4932
149 5LKS 56 SL 40S ribosomal protein S11 9606
150 5K0Y 5 G ribosomal protein uS17 9986
151 5JUO 61 IB uS17 (yeast S11) 4932
152 5JUP 61 IB uS17 (yeast S11) 4932
153 5JUS 61 IB uS17 (yeast S11) 4932
154 5JUT 61 IB uS17 (yeast S11) 4932
155 5JUU 61 IB uS17 (yeast S11) 4932
156 5JPQ 31 y uS17 209285
157 5IT7 59 L KLLA0A10483p 28985
158 5IT9 12 L Ribosomal protein uS17 28985
159 5FLX 13 L 40S RIBOSOMAL PROTEIN S11 9986
160 3JBN 31 V 40S ribosomal protein uS17 5833
161 3JBO 8 V 40S ribosomal protein uS17 5833
162 3JBP 31 V 40S ribosomal protein uS17 5833
163 3JAP 15 L uS17 28985
164 3JAQ 15 L uS17 28985
165 3JAM 13 L uS17 28985
166 3JAN 62 SL Ribosomal protein uS17 SEE REMARK 999 9986
167 3JAJ 63 SL Ribosomal protein uS17 SEE REMARK 999 9986
168 3JAG 63 LL uS17 9986
169 3JAH 63 LL uS17 9986
170 3JAI 63 LL uS17 9986
171 5A2Q 14 L RIBOSOMAL PROTEIN US17 9606
172 4UG0 57 SL 40S RIBOSOMAL PROTEIN S11 9606
173 5AJ0 61 BL 40S ribosomal protein S11 9606
174 4UER 27 Q US17 4934
175 4D61 13 L 40S RIBOSOMAL PROTEIN S11 9986
176 4D5L 13 L 40S RIBOSOMAL PROTEIN US17 9986
177 3J81 13 L uS17 28985
178 3J80 10 L uS17 28985
179 3J7P 61 SL Ribosomal protein uS17 9823
180 3J7R 62 SL Ribosomal protein uS17 9823
181 4UJC 62 CL 40S RIBOSOMAL PROTEIN US17 9986
182 4UJD 62 CL 40S RIBOSOMAL PROTEIN US17 9986
183 3J7A 22 V 40S ribosomal protein uS17 5833
184 3J77 57 11 40S ribosomal protein S11 4932
185 3J78 57 11 40S ribosomal protein S11 4932
186 3J6X 58 11 40S ribosomal protein S11 4932
187 3J6Y 58 11 40S ribosomal protein S11 4932
188 4UJE 16 BL 40S RIBOSOMAL PROTEIN S11 9986
189 4V92 14 BL US17 28985
190 4V7E 19 BL 40S ribosomal protein S17 4565
191 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
192 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
193 4V6W 11 AL 40S ribosomal protein S11 7227
194 4V6X 11 AL 40S ribosomal protein S11 9606
195 4V8M 13 AE 40S RIBOSOMAL PROTEINS S11, PUTATIVE 185431
196 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932
197 4V5Z 23 Aq 40S Ribosomal protein S11e 9612