
Crystal structure of Lactimidomycin bound to the yeast 80S ribosome

Sequence Similarity Clusters for the Entities in PDB 4U4R

Entity #1 | Chains: 2,6
18S ribosomal RNA rna, length: 1800 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: S8,s8
40S ribosomal protein S8-A protein, length: 200 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 90 366
95 % 2 90 464
90 % 2 96 453
70 % 2 113 413
50 % 2 227 236
40 % 2 231 237
30 % 2 231 244
Entity #11 | Chains: S9,s9
40S ribosomal protein S9-A protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 317
95 % 2 101 406
90 % 2 113 358
70 % 2 223 234
50 % 2 234 223
40 % 2 249 217
30 % 2 249 223
Entity #12 | Chains: C0,c0
40S ribosomal protein S10-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 20 1549
95 % 2 71 622
90 % 2 74 602
70 % 2 90 523
50 % 2 90 554
40 % 2 89 593
30 % 2 90 619
Entity #13 | Chains: C1,c1
40S ribosomal protein S11-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 328
95 % 2 98 422
90 % 2 107 384
70 % 2 115 396
50 % 2 226 232
40 % 2 228 233
30 % 2 234 241
Entity #14 | Chains: C2,c2
40S ribosomal protein S12 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 38 1072
95 % 2 56 760
90 % 2 58 746
70 % 2 92 495
50 % 2 92 530
40 % 2 95 552
30 % 2 95 581
Entity #15 | Chains: C3,c3
40S ribosomal protein S13 protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 329
95 % 2 98 425
90 % 2 108 383
70 % 2 229 227
50 % 2 235 231
40 % 2 247 218
30 % 2 247 224
Entity #16 | Chains: C4,c4
40S ribosomal protein S14-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 504
95 % 2 128 351
90 % 2 110 371
70 % 2 233 218
50 % 2 237 226
40 % 2 237 228
30 % 2 237 235
Entity #17 | Chains: C5,c5
40S ribosomal protein S15 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 62 535
95 % 2 72 534
90 % 2 72 560
70 % 2 91 489
50 % 2 201 284
40 % 2 212 268
30 % 2 212 280
Entity #18 | Chains: C6,c6
40S ribosomal protein S16-A protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 100 314
95 % 2 111 352
90 % 2 111 365
70 % 2 112 412
50 % 2 228 234
40 % 2 239 227
30 % 2 238 230
Entity #19 | Chains: C7,c7
40S ribosomal protein S17-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 409
95 % 2 76 525
90 % 2 88 492
70 % 2 88 518
50 % 2 204 276
40 % 2 205 283
30 % 2 204 297
Entity #2 | Chains: S0,s0
40S ribosomal protein S0-A protein, length: 251 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 52 622
95 % 2 55 779
90 % 2 55 808
70 % 2 63 756
50 % 2 72 712
40 % 2 141 397
30 % 2 141 412
Entity #20 | Chains: C8,c8
40S ribosomal protein S18-A protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 89 360
95 % 2 90 453
90 % 2 100 425
70 % 2 215 241
50 % 2 224 239
40 % 2 236 230
30 % 2 237 237
Entity #21 | Chains: C9,c9
40S ribosomal protein S19-A protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 84 374
95 % 2 84 475
90 % 2 84 496
70 % 2 96 470
50 % 2 97 502
40 % 2 201 291
30 % 2 209 284
Entity #22 | Chains: D0,d0
40S ribosomal protein S20 protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 384
95 % 2 80 492
90 % 2 79 512
70 % 2 92 482
50 % 2 92 523
40 % 2 94 527
30 % 2 94 557
Entity #23 | Chains: D1,d1
40S ribosomal protein S21-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 398
95 % 2 79 503
90 % 2 91 472
70 % 2 91 496
50 % 2 200 287
40 % 2 200 298
30 % 2 200 310
Entity #24 | Chains: D2,d2
40S ribosomal protein S22-A protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 92 351
95 % 2 114 341
90 % 2 112 360
70 % 2 238 220
50 % 2 240 222
40 % 3 252 213
30 % 38 896 20
Entity #25 | Chains: D3,d3
40S ribosomal protein S23-A protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 325
95 % 2 111 357
90 % 2 110 378
70 % 2 247 211
50 % 2 255 204
40 % 2 255 210
30 % 2 255 220
Entity #26 | Chains: D4,d4
40S ribosomal protein S24-A protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 332
95 % 2 98 426
90 % 2 110 389
70 % 2 113 401
50 % 2 229 238
40 % 2 229 240
30 % 2 229 250
Entity #27 | Chains: D5,d5
40S ribosomal protein S25-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 56 583
95 % 2 56 765
90 % 2 56 798
70 % 2 64 747
50 % 2 64 781
40 % 2 63 806
30 % 2 66 836
Entity #28 | Chains: D6,d6
40S ribosomal protein S26-B protein, length: 97 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 49 598
95 % 1 84 784
90 % 1 53 773
70 % 1 53 798
50 % 1 91 550
40 % 1 91 587
30 % 1 91 613
Entity #29 | Chains: D7,d7
40S ribosomal protein S27-A protein, length: 81 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 348
95 % 2 104 388
90 % 2 103 411
70 % 2 207 244
50 % 2 219 241
40 % 2 224 243
30 % 2 224 251
Entity #3 | Chains: S1,s1
40S ribosomal protein S1-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 87 355
95 % 2 93 444
90 % 2 103 426
70 % 2 108 424
50 % 2 116 440
40 % 2 197 293
30 % 2 197 307
Entity #30 | Chains: D8,d8
40S ribosomal protein S28-A protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 92 361
95 % 2 111 354
90 % 2 109 374
70 % 2 229 229
50 % 2 243 214
40 % 2 244 219
30 % 2 244 226
Entity #31 | Chains: D9,d9
40S ribosomal protein S29-A protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 392
95 % 2 78 500
90 % 2 79 517
70 % 2 190 266
50 % 2 200 286
40 % 2 200 295
30 % 2 205 305
Entity #32 | Chains: E0
40S ribosomal protein S30-A protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 383
95 % 2 99 493
90 % 2 111 466
70 % 2 11 487
50 % 2 191 337
40 % 2 191 351
30 % 2 189 368
Entity #33 | Chains: E1,e1
Ubiquitin-40S ribosomal protein S31 protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 39 807
95 % 1 44 973
90 % 1 44 1005
70 % 1 83 605
50 % 1 87 615
40 % 1 87 660
30 % 1 87 682
Entity #34 | Chains: SR,sR
Guanine nucleotide-binding protein subunit beta-like protein protein, length: 318 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 76 402
95 % 3 83 462
90 % 3 83 480
70 % 3 83 504
50 % 5 197 268
40 % 5 203 256
30 % 5 206 266
Entity #35 | Chains: SM,sM
Suppressor protein STM1 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1105
95 % 1 27 1425
90 % 1 27 1472
70 % 3 33 1296
50 % 3 33 1328
40 % 3 33 1362
30 % 3 33 1401
Entity #36 | Chains: 1,5
25S ribosomal RNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #37 | Chains: 3,7
5S ribosomal RNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #38 | Chains: 4,8
5.8S ribosomal RNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #39 | Chains: L2,l2
60S ribosomal protein L2-A protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 300
95 % 2 106 382
90 % 2 108 397
70 % 2 195 268
50 % 2 207 267
40 % 47 275 196
30 % 47 271 206
Entity #4 | Chains: S2,s2
40S ribosomal protein S2 protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 84 595
95 % 2 85 774
90 % 2 55 803
70 % 2 63 761
50 % 2 70 735
40 % 2 70 762
30 % 2 70 805
Entity #40 | Chains: L3,l3
60S ribosomal protein L3 protein, length: 386 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 288
95 % 2 112 345
90 % 2 115 352
70 % 2 114 395
50 % 2 220 251
40 % 2 220 253
30 % 2 221 260
Entity #41 | Chains: L4,l4
60S ribosomal protein L4-A protein, length: 361 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 112 273
95 % 2 116 327
90 % 2 117 346
70 % 2 119 379
50 % 2 167 341
40 % 2 218 254
30 % 2 219 264
Entity #42 | Chains: L5,l5
60S ribosomal protein L5 protein, length: 296 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 312
95 % 2 103 400
90 % 2 103 420
70 % 2 105 440
50 % 2 200 283
40 % 2 204 284
30 % 2 205 298
Entity #43 | Chains: L6,l6
60S ribosomal protein L6-A protein, length: 175 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 292
95 % 2 112 350
90 % 2 113 362
70 % 2 116 390
50 % 2 117 434
40 % 2 160 449
30 % 2 121 464
Entity #44 | Chains: L7,l7
60S ribosomal protein L7-A protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 272
95 % 2 113 344
90 % 2 112 363
70 % 2 117 394
50 % 2 206 273
40 % 2 207 279
30 % 2 198 296
Entity #45 | Chains: L8,l8
60S ribosomal protein L8-A protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 109 311
95 % 2 116 347
90 % 2 116 361
70 % 2 118 393
50 % 2 191 308
40 % 2 193 317
30 % 2 193 332
Entity #46 | Chains: L9,l9
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 279
95 % 2 111 348
90 % 2 128 368
70 % 2 114 403
50 % 2 215 263
40 % 2 215 260
30 % 2 216 270
Entity #47 | Chains: M0,m0
60S ribosomal protein L10 protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 88 365
95 % 2 88 460
90 % 2 90 467
70 % 2 96 488
50 % 2 190 304
40 % 2 192 316
30 % 2 190 328
Entity #48 | Chains: M1,m1
60S ribosomal protein L11-B protein, length: 173 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 25 1143
95 % 2 104 385
90 % 2 108 401
70 % 3 206 252
50 % 3 210 266
40 % 3 212 271
30 % 3 210 283
Entity #49 | Chains: M3,m3
60S ribosomal protein L13-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 17 286
95 % 2 111 366
90 % 2 108 387
70 % 2 113 416
50 % 2 113 462
40 % 2 205 288
30 % 2 200 300
Entity #5 | Chains: S3,s3
40S ribosomal protein S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 78 388
95 % 3 78 494
90 % 3 78 519
70 % 3 90 491
50 % 3 191 302
40 % 3 191 314
30 % 3 191 325
Entity #50 | Chains: M4,m4
60S ribosomal protein L14-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 112 276
95 % 2 115 342
90 % 2 113 364
70 % 2 114 398
50 % 2 114 453
40 % 2 131 473
30 % 2 115 496
Entity #51 | Chains: M5,m5
60S ribosomal protein L15-A protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 115 264
95 % 2 117 325
90 % 2 118 345
70 % 2 205 255
50 % 2 216 253
40 % 2 219 255
30 % 2 215 269
Entity #52 | Chains: M6,m6
60S ribosomal protein L16-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 303
95 % 2 105 390
90 % 2 111 369
70 % 2 114 402
50 % 2 207 270
40 % 2 207 275
30 % 2 206 291
Entity #53 | Chains: M7,m7
60S ribosomal protein L17-A protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 116 260
95 % 2 52 330
90 % 2 118 343
70 % 2 118 383
50 % 2 217 254
40 % 2 217 258
30 % 2 215 272
Entity #54 | Chains: M8,m8
60S ribosomal protein L18-A protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 112 274
95 % 2 112 346
90 % 2 115 355
70 % 2 131 397
50 % 2 208 278
40 % 2 213 273
30 % 2 213 286
Entity #55 | Chains: M9,m9
60S ribosomal protein L19-A protein, length: 188 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 294
95 % 2 106 378
90 % 2 107 405
70 % 2 110 423
50 % 2 207 275
40 % 2 206 277
30 % 2 208 295
Entity #56 | Chains: N0,n0
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 285
95 % 2 111 365
90 % 2 127 372
70 % 2 113 415
50 % 2 198 299
40 % 2 199 304
30 % 2 231 314
Entity #57 | Chains: N1,n1
60S ribosomal protein L21-A protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 293
95 % 2 107 377
90 % 2 109 391
70 % 2 109 425
50 % 2 197 301
40 % 2 197 301
30 % 2 209 287
Entity #58 | Chains: N2,n2
60S ribosomal protein L22-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 81 432
95 % 2 81 548
90 % 2 81 576
70 % 2 82 590
50 % 2 82 635
40 % 2 82 677
30 % 2 83 677
Entity #59 | Chains: N3,n3
60S ribosomal protein L23-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 262
95 % 2 114 335
90 % 2 116 349
70 % 2 219 240
50 % 2 225 248
40 % 2 225 249
30 % 5 232 247
Entity #6 | Chains: S4,s4
40S ribosomal protein S4-A protein, length: 260 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 334
95 % 2 97 429
90 % 2 105 396
70 % 2 218 239
50 % 2 228 235
40 % 2 232 236
30 % 2 240 227
Entity #60 | Chains: N4,n4
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 68 503
95 % 2 70 639
90 % 2 70 667
70 % 2 71 685
50 % 2 71 718
40 % 2 128 468
30 % 2 128 489
Entity #61 | Chains: N5,n5
60S ribosomal protein L25 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 86 406
95 % 2 86 518
90 % 2 87 537
70 % 2 87 564
50 % 2 87 595
40 % 2 26 628
30 % 2 90 646
Entity #62 | Chains: N6,n6
60S ribosomal protein L26-A protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 82 253
95 % 2 118 321
90 % 2 120 332
70 % 2 120 373
50 % 2 215 257
40 % 2 214 263
30 % 2 215 277
Entity #63 | Chains: N7,n7
60S ribosomal protein L27-A protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 298
95 % 2 107 383
90 % 2 106 398
70 % 2 109 431
50 % 2 192 306
40 % 2 206 285
30 % 2 208 294
Entity #64 | Chains: N8,n8
60S ribosomal protein L28 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 304
95 % 2 108 368
90 % 2 110 382
70 % 2 110 420
50 % 2 209 265
40 % 2 211 270
30 % 2 216 274
Entity #65 | Chains: N9,n9
60S ribosomal protein L29 protein, length: 58 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 345
95 % 2 94 441
90 % 2 96 456
70 % 2 96 474
50 % 2 96 518
40 % 2 95 542
30 % 2 96 574
Entity #66 | Chains: O0,o0
60S ribosomal protein L30 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 130 267
95 % 3 112 337
90 % 3 52 351
70 % 3 115 386
50 % 3 156 363
40 % 3 156 379
30 % 3 156 391
Entity #67 | Chains: O1,o1
60S ribosomal protein L31-A protein, length: 112 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 110 280
95 % 2 111 353
90 % 2 111 375
70 % 2 112 409
50 % 2 206 271
40 % 2 207 278
30 % 2 207 293
Entity #68 | Chains: O2,o2
60S ribosomal protein L32 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 270
95 % 2 114 338
90 % 2 114 356
70 % 2 115 389
50 % 2 204 264
40 % 2 215 261
30 % 2 214 275
Entity #69 | Chains: O3,o3
60S ribosomal protein L33-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 110 283
95 % 2 110 360
90 % 2 112 381
70 % 2 114 411
50 % 2 230 291
40 % 2 205 297
30 % 2 206 306
Entity #7 | Chains: S5,s5
40S ribosomal protein S5 protein, length: 224 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 323
95 % 2 100 409
90 % 2 112 367
70 % 2 112 414
50 % 2 239 219
40 % 2 239 225
30 % 2 197 233
Entity #70 | Chains: O4,o4
60S ribosomal protein L34-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 299
95 % 2 107 384
90 % 2 107 409
70 % 2 106 433
50 % 2 192 307
40 % 2 192 318
30 % 2 191 336
Entity #71 | Chains: O5,o5
60S ribosomal protein L35-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 117 258
95 % 2 117 324
90 % 2 117 344
70 % 2 119 378
50 % 2 210 272
40 % 2 221 252
30 % 2 223 259
Entity #72 | Chains: O6,o6
60S ribosomal protein L36-A protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 295
95 % 2 111 358
90 % 2 112 373
70 % 2 112 407
50 % 2 114 461
40 % 2 195 302
30 % 2 210 290
Entity #73 | Chains: O7,o7
60S ribosomal protein L37-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 263
95 % 2 113 336
90 % 2 112 357
70 % 2 170 296
50 % 2 215 256
40 % 2 215 262
30 % 2 215 276
Entity #74 | Chains: O8,o8
60S ribosomal protein L38 protein, length: 77 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 297
95 % 2 107 381
90 % 2 103 408
70 % 2 108 428
50 % 2 109 470
40 % 2 116 463
30 % 2 116 481
Entity #75 | Chains: O9,o9
60S ribosomal protein L39 protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 110 282
95 % 2 111 356
90 % 2 111 377
70 % 2 198 265
50 % 2 214 255
40 % 2 216 259
30 % 2 210 273
Entity #76 | Chains: Q0,q0
Ubiquitin-60S ribosomal protein L40 protein, length: 52 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 50 582
95 % 1 51 757
90 % 1 51 793
70 % 1 91 484
50 % 1 97 524
40 % 1 96 560
30 % 1 97 590
Entity #77 | Chains: Q1,q1
60S ribosomal protein L41-A protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 84 371
95 % 2 86 470
90 % 2 86 491
70 % 2 183 277
50 % 2 183 314
40 % 2 183 324
30 % 2 183 343
Entity #78 | Chains: Q2,q2
60S ribosomal protein L42-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 319
95 % 2 98 417
90 % 2 101 431
70 % 2 194 269
50 % 2 202 288
40 % 2 202 296
30 % 2 202 309
Entity #79 | Chains: Q3,q3
60S ribosomal protein L43-A protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 306
95 % 2 103 399
90 % 2 103 421
70 % 2 105 441
50 % 2 205 277
40 % 2 206 282
30 % 23 229 253
Entity #8 | Chains: S6,s6
40S ribosomal protein S6-A protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 96 342
95 % 2 91 436
90 % 2 97 454
70 % 2 109 435
50 % 2 215 252
40 % 2 219 250
30 % 2 224 258
Entity #80 | Chains: e0
40S ribosomal protein S30-A protein, length: 62 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 99 383
95 % 3 99 493
90 % 3 111 466
70 % 3 11 487
50 % 3 191 337
40 % 3 191 351
30 % 3 189 368
Entity #81 | Chains: m2
Unknown protein m2 protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #82 | Chains: p0
60S acidic ribosomal protein P0 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 55421
95 % 1 44 1555
90 % 2 48 1453
70 % 2 49 1455
50 % 2 74 979
40 % 2 74 1002
30 % 2 74 1049
Entity #83 | Chains: p1
Unknown protein p1 protein, length: 47 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #84 | Chains: p2
Unknown protein p2 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #9 | Chains: S7,s7
40S ribosomal protein S7-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 91 340
95 % 2 96 437
90 % 2 108 406
70 % 2 104 436
50 % 2 224 243
40 % 2 224 245
30 % 2 226 246


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
34 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
35 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
36 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
37 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
39 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
40 4V7R 7 AF, CF 40S ribosomal protein S11 4932
41 5VYC 30 L1, L2, L3, L4, L5, L6 40S ribosomal protein S11 9606
42 4KZZ 12 L 40S Ribosomal Protein S11 9986
43 4KZX 12 L 40S ribosomal protein S11 9986
44 4KZY 12 L 40S Ribosomal Protein S11 9986
45 6ZVH 10 L 40S ribosomal protein S11 9606
46 6ZVI 16 t 40S ribosomal protein S11-A 4932
47 6ZQB 55 DL 40S ribosomal protein S11-A 4932
48 6ZQC 55 DL 40S ribosomal protein S11-A 4932
49 6ZQD 51 DL 40S ribosomal protein S11-A 4932
50 6ZQE 47 DL 40S ribosomal protein S11-A 4932
51 6ZQF 33 DL 40S ribosomal protein S11-A 4932
52 6ZQG 25 DL 40S ribosomal protein S11-A 4932
53 6ZP4 11 n 40S ribosomal protein S11 9606
54 6ZOJ 13 L 40S ribosomal protein S11 9606
55 6ZOK 10 L 40S ribosomal protein S11 9606
56 6ZON 11 n 40S ribosomal protein S11 9606
57 6ZN5 11 L 40S ribosomal protein S11 9606
58 6ZMW 25 B 40S ribosomal protein S11 9606
59 6ZMO 58 SL 40S ribosomal protein S11 9606
60 6ZMT 11 L 40S ribosomal protein S11 9606
61 6ZME 58 SL 40S ribosomal protein S11 9606
62 6ZMI 58 SL 40S ribosomal protein S11 9606
63 6ZLW 11 L 40S ribosomal protein S11 9606
64 6ZM7 58 SL 40S ribosomal protein S11 9606
65 6XIQ 27 AB 40S ribosomal protein S11-A 4932
66 6XIR 27 AB 40S ribosomal protein S11-A 4932
67 6Z6J 17 SL 40S ribosomal protein S11-A 4932
68 6Z6K 17 SL 40S ribosomal protein S11-A 4932
69 6Z6L 56 SL 40S ribosomal protein S11 9606
70 6Z6M 56 SL 40S ribosomal protein S11 9606
71 6Z6N 56 SL 40S ribosomal protein S11 9606
72 6WOO 59 LL uS17 4932
73 6YBW 2 B 40S ribosomal protein S11 9606
74 6YAL 14 N 40S ribosomal protein uS17 9986
75 6YAM 14 N 40S ribosomal protein uS17 9986
76 6YAN 13 N Ribosomal protein S11 9986
77 6W2S 11 M uS17 9986
78 6W2T 10 M uS17 9986
79 6Y7C 11 L 40S ribosomal protein S11-A 4932
80 6Y57 61 SL 40S ribosomal protein S11 9606
81 6Y2L 61 SL 40S ribosomal protein S11 9606
82 6Y0G 61 SL 40S ribosomal protein S11 9606
83 6LQP 11 SM 40S ribosomal protein S11-A 4932
84 6LQQ 11 SM 40S ribosomal protein S11-A 4932
85 6LQR 11 SM 40S ribosomal protein S11-A 4932
86 6LQS 11 SM 40S ribosomal protein S11-A 4932
87 6LQT 11 SM 40S ribosomal protein S11-A 4932
88 6LQU 10 SM 40S ribosomal protein S11-A 4932
89 6LQV 9 SM 40S ribosomal protein S11-A 4932
90 6TNU 15 X 40S ribosomal protein S11-A 4932
91 6UZ7 59 L KLLA0A10483p 28985
92 6TB3 15 X 40S ribosomal protein S11-A 4932
93 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
94 6T7T 16 SL 40S ribosomal protein S11-A 4932
95 6T7I 14 SL 40S ribosomal protein S11-A 4932
96 6T4Q 13 SL 40S ribosomal protein S11-A 4932
97 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
98 6SNT 14 L 40S ribosomal protein S11-A 4932
99 6SGC 13 M1 Ribosomal protein S11 9986
100 6KE6 11 SM 40S ribosomal protein S11-A 4932
101 6S47 57 BM 40S ribosomal protein S11-A 4932
102 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
103 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
104 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
105 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
106 6P5I 13 M uS17 9986
107 6P5J 13 M uS17 9986
108 6P5K 59 M uS17 9986
109 6P5N 59 M uS17 9986
110 6P4G 13 M uS17 9986
111 6P4H 14 M uS17 9986
112 6OM7 10 SL 40S ribosomal protein S11 9606
113 6OLZ 58 BL 40S ribosomal protein S11 9606
114 6OM0 10 SL 40S ribosomal protein S11 9606
115 6OLE 10 SL 40S ribosomal protein S11 9606
116 6OLF 10 SL 40S ribosomal protein S11 9606
117 6OLG 61 BL 40S ribosomal protein S11 9606
118 6OLI 10 SL 40S ribosomal protein S11 9606
119 6OKK 22 V 40S ribosomal protein S11 5833
120 6RBD 12 L 40S ribosomal protein S11-A 4932
121 6RBE 10 L 40S ribosomal protein S11-A 4932
122 6R7Q 5 EE Ribosomal protein S11 9986
123 6R6G 19 EE Ribosomal protein S11 9986
124 6R6P 60 EE Ribosomal protein S11 9986
125 6R5Q 63 EE Ribosomal protein S11 9986
126 6QZP 57 SL 40S ribosomal protein S11 9606
127 6Q8Y 79 X 40S ribosomal protein S11-A 4932
128 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
129 6IP5 56 2v 40S ribosomal protein S11 9606
130 6IP6 55 2v 40S ribosomal protein S11 9606
131 6IP8 55 2v 40S ribosomal protein S11 9606
132 6MTB 62 LL 40S ribosomal protein S11 9986
133 6MTC 61 LL 40S ribosomal protein S11 9986
134 6MTD 63 LL uS17 9986
135 6MTE 62 LL uS17 9986
136 6HCQ 16 M2 Ribosomal protein S11 9986
137 6HCJ 16 M2 Ribosomal protein S11 9986
138 6HCM 13 M1 Ribosomal protein S11 9986
139 6HCF 13 M1 Ribosomal protein S11 9986
140 6GZ3 29 BL Ribosomal protein S11 9986
141 6GZ4 32 BL ribosomal protein uS17 9986
142 6GZ5 29 BL ribosomal protein uS17 9986
143 6GSM 15 L KLLA0A10483p 28985
144 6GSN 36 L KLLA0A10483p 28985
145 6GQV 59 AB 40S ribosomal protein S11-A 4932
146 6GQ1 59 AB 40S ribosomal protein S11-A 4932
147 6GQB 59 AB 40S ribosomal protein S11-A 4932
148 6D9J 61 MM uS17 9986
149 6D90 62 MM uS17 9986
150 6G5H 10 L 40S ribosomal protein S11 9606
151 6G5I 13 L 40S ribosomal protein S11 9606
152 6G4S 29 L 40S ribosomal protein S11 9606
153 6G4W 25 L 40S ribosomal protein S11 9606
154 6G51 11 L 40S ribosomal protein S11 9606
155 6G53 11 L 40S ribosomal protein S11 9606
156 6G18 21 L 40S ribosomal protein S11 9606
157 6FYX 15 L KLLA0A10483p 28985
158 6FYY 15 L KLLA0A10483p 28985
159 6FEC 12 G 40S ribosomal protein S11 9606
160 6FAI 22 L 40S ribosomal protein S11-A 4932
161 6EML 20 X 40S ribosomal protein S11-A 4932
162 6EK0 57 SL 40S ribosomal protein S11 9606
163 6AZ1 21 U ribosomal protein S17 5661
164 5OQL 44 v 40S ribosomal protein S11-like protein 209285
165 5OPT 16 X 40S ribosomal protein S11, putative 5693
166 5WLC 12 LD rpS11_uS17 4932
167 5XYI 13 L Uncharacterized protein 5722
168 5XXU 13 L Ribosomal protein uS17 5811
169 5OA3 16 L 40S ribosomal protein S11 9606
170 5WYJ 42 SM 40S ribosomal protein S11-A 4932
171 5WYK 39 SM 40S ribosomal protein S11-A 4932
172 5TZS 13 D rpS11_uS17 4932
173 5MC6 25 X 40S ribosomal protein S11-A 4932
174 5M1J 19 L2 40S ribosomal protein S11-A 4932
175 5LZS 62 LL uS17 9986
176 5LZT 63 LL uS17 9986
177 5LZU 62 LL uS17 9986
178 5LZV 63 LL uS17 9986
179 5LZW 63 LL uS17 9986
180 5LZX 63 LL uS17 9986
181 5LZY 61 LL uS17 9986
182 5LZZ 63 LL uS17 9986
183 5T2A 61 AE uS17 5661
184 5T2C 73 Aw 40S ribosomal protein S11 9606
185 5LL6 10 X 40S ribosomal protein S11-A 4932
186 5LKS 56 SL 40S ribosomal protein S11 9606
187 5K0Y 5 G ribosomal protein uS17 9986
188 5JUO 61 IB uS17 (yeast S11) 4932
189 5JUP 61 IB uS17 (yeast S11) 4932
190 5JUS 61 IB uS17 (yeast S11) 4932
191 5JUT 61 IB uS17 (yeast S11) 4932
192 5JUU 61 IB uS17 (yeast S11) 4932
193 5JPQ 31 y uS17 209285
194 5IT7 59 L KLLA0A10483p 28985
195 5IT9 12 L Ribosomal protein uS17 28985
196 5FLX 13 L 40S RIBOSOMAL PROTEIN S11 9986
197 3JBN 31 V 40S ribosomal protein uS17 5833
198 3JBO 8 V 40S ribosomal protein uS17 5833
199 3JBP 31 V 40S ribosomal protein uS17 5833
200 3JAP 15 L uS17 28985
201 3JAQ 15 L uS17 28985
202 3JAM 13 L uS17 28985
203 3JAN 62 SL Ribosomal protein uS17 SEE REMARK 999 9986
204 3JAJ 63 SL Ribosomal protein uS17 SEE REMARK 999 9986
205 3JAG 63 LL uS17 9986
206 3JAH 63 LL uS17 9986
207 3JAI 63 LL uS17 9986
209 4UG0 57 SL 40S RIBOSOMAL PROTEIN S11 9606
210 5AJ0 61 BL 40S ribosomal protein S11 9606
211 4UER 27 Q US17 4934
212 4D61 13 L 40S RIBOSOMAL PROTEIN S11 9986
213 4D5L 13 L 40S RIBOSOMAL PROTEIN US17 9986
214 3J81 13 L uS17 28985
215 3J80 10 L uS17 28985
216 3J7P 61 SL Ribosomal protein uS17 9823
217 3J7R 62 SL Ribosomal protein uS17 9823
220 3J7A 22 V 40S ribosomal protein uS17 5833
221 3J77 57 11 40S ribosomal protein S11 4932
222 3J78 57 11 40S ribosomal protein S11 4932
223 3J6X 58 11 40S ribosomal protein S11 4932
224 3J6Y 58 11 40S ribosomal protein S11 4932
226 4V92 14 BL US17 28985
227 4V7E 19 BL 40S ribosomal protein S17 4565
228 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
229 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
230 4V6W 11 AL 40S ribosomal protein S11 7227
231 4V6X 11 AL 40S ribosomal protein S11 9606
233 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932
234 4V5Z 23 Aq 40S Ribosomal protein S11e 9612