
Crystal structure of Lactimidomycin bound to the yeast 80S ribosome

Sequence Similarity Clusters for the Entities in PDB 4U4R

Entity #1 | Chains: 2,6
18S ribosomal RNA rna, length: 1800 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: S8,s8
40S ribosomal protein S8-A protein, length: 200 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 412
95 % 2 70 528
90 % 2 76 510
70 % 2 93 460
50 % 2 190 260
40 % 2 194 260
30 % 2 194 272
Entity #11 | Chains: S9,s9
40S ribosomal protein S9-A protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 350
95 % 2 80 459
90 % 2 92 428
70 % 2 185 250
50 % 2 200 236
40 % 2 208 236
30 % 2 208 246
Entity #12 | Chains: C0,c0
40S ribosomal protein S10-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 19 1547
95 % 2 65 614
90 % 2 68 624
70 % 2 84 537
50 % 2 84 564
40 % 2 84 604
30 % 2 84 621
Entity #13 | Chains: C1,c1
40S ribosomal protein S11-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 358
95 % 2 78 471
90 % 2 90 438
70 % 2 95 449
50 % 2 197 244
40 % 2 197 253
30 % 2 197 264
Entity #14 | Chains: C2,c2
40S ribosomal protein S12 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 33 1147
95 % 2 51 774
90 % 2 53 771
70 % 2 85 506
50 % 2 85 533
40 % 2 88 559
30 % 2 88 581
Entity #15 | Chains: C3,c3
40S ribosomal protein S13 protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 362
95 % 2 78 472
90 % 2 90 441
70 % 2 190 248
50 % 2 197 246
40 % 2 205 239
30 % 2 206 248
Entity #16 | Chains: C4,c4
40S ribosomal protein S14-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 349
95 % 2 92 413
90 % 2 92 427
70 % 2 198 227
50 % 2 199 238
40 % 2 199 247
30 % 2 199 259
Entity #17 | Chains: C5,c5
40S ribosomal protein S15 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 58 533
95 % 2 68 548
90 % 2 68 576
70 % 2 86 499
50 % 2 179 302
40 % 2 187 286
30 % 2 187 304
Entity #18 | Chains: C6,c6
40S ribosomal protein S16-A protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 348
95 % 2 91 416
90 % 2 92 430
70 % 2 92 461
50 % 2 190 253
40 % 2 198 249
30 % 2 199 260
Entity #19 | Chains: C7,c7
40S ribosomal protein S17-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 415
95 % 2 70 531
90 % 2 82 491
70 % 2 82 518
50 % 2 176 304
40 % 2 176 310
30 % 2 176 327
Entity #2 | Chains: S0,s0
40S ribosomal protein S0-A protein, length: 251 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 606
95 % 2 51 787
90 % 2 51 820
70 % 2 59 759
50 % 2 68 715
40 % 2 133 403
30 % 2 133 414
Entity #20 | Chains: C8,c8
40S ribosomal protein S18-A protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 371
95 % 2 76 479
90 % 2 88 452
70 % 2 183 254
50 % 2 192 252
40 % 2 202 242
30 % 2 202 255
Entity #21 | Chains: C9,c9
40S ribosomal protein S19-A protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 74 375
95 % 2 74 488
90 % 2 74 515
70 % 2 86 492
50 % 2 87 519
40 % 2 87 554
30 % 2 88 574
Entity #22 | Chains: D0,d0
40S ribosomal protein S20 protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 381
95 % 2 74 494
90 % 2 74 523
70 % 2 86 496
50 % 2 86 525
40 % 2 88 537
30 % 2 88 564
Entity #23 | Chains: D1,d1
40S ribosomal protein S21-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 386
95 % 2 73 501
90 % 2 85 473
70 % 2 85 501
50 % 2 171 317
40 % 2 171 327
30 % 2 171 341
Entity #24 | Chains: D2,d2
40S ribosomal protein S22-A protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 364
95 % 2 94 411
90 % 2 94 425
70 % 2 201 234
50 % 2 203 231
40 % 3 212 230
30 % 38 808 23
Entity #25 | Chains: D3,d3
40S ribosomal protein S23-A protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 366
95 % 2 90 421
90 % 2 90 435
70 % 2 204 222
50 % 2 214 221
40 % 2 214 227
30 % 2 214 235
Entity #26 | Chains: D4,d4
40S ribosomal protein S24-A protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 365
95 % 2 78 476
90 % 2 90 446
70 % 2 90 474
50 % 2 192 267
40 % 2 192 280
30 % 2 192 292
Entity #27 | Chains: D5,d5
40S ribosomal protein S25-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 50 590
95 % 2 50 796
90 % 2 50 831
70 % 2 58 775
50 % 2 58 807
40 % 2 58 837
30 % 2 60 857
Entity #28 | Chains: D6,d6
40S ribosomal protein S26-B protein, length: 97 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 47 570
95 % 1 47 762
90 % 1 51 757
70 % 1 51 779
50 % 1 85 552
40 % 1 85 591
30 % 1 85 608
Entity #29 | Chains: D7,d7
40S ribosomal protein S27-A protein, length: 81 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 378
95 % 2 87 441
90 % 2 87 468
70 % 2 175 270
50 % 2 187 268
40 % 2 187 281
30 % 2 187 295
Entity #3 | Chains: S1,s1
40S ribosomal protein S1-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 384
95 % 2 74 499
90 % 2 84 478
70 % 2 91 470
50 % 2 97 470
40 % 2 161 336
30 % 2 161 355
Entity #30 | Chains: D8,d8
40S ribosomal protein S28-A protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 632
95 % 2 90 419
90 % 2 90 436
70 % 2 191 247
50 % 2 202 232
40 % 2 203 241
30 % 2 203 252
Entity #31 | Chains: D9,d9
40S ribosomal protein S29-A protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 383
95 % 2 72 504
90 % 2 73 528
70 % 2 168 281
50 % 2 176 294
40 % 2 176 305
30 % 2 176 325
Entity #32 | Chains: E0
40S ribosomal protein S30-A protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 370
95 % 2 95 481
90 % 2 107 456
70 % 2 107 484
50 % 2 171 360
40 % 2 171 371
30 % 2 171 385
Entity #33 | Chains: E1,e1
Ubiquitin-40S ribosomal protein S31 protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 39 774
95 % 1 43 949
90 % 1 43 982
70 % 1 78 627
50 % 1 82 628
40 % 1 82 667
30 % 1 82 685
Entity #34 | Chains: SR,sR
Guanine nucleotide-binding protein subunit beta-like protein protein, length: 318 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 71 394
95 % 3 77 452
90 % 3 77 481
70 % 3 77 508
50 % 5 176 280
40 % 5 182 271
30 % 5 183 283
Entity #35 | Chains: SM,sM
Suppressor protein STM1 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1033
95 % 1 27 1370
90 % 1 27 1410
70 % 3 33 1227
50 % 3 33 1278
40 % 3 33 1315
30 % 3 33 1349
Entity #36 | Chains: 1,5
25S ribosomal RNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #37 | Chains: 3,7
5S ribosomal RNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #38 | Chains: 4,8
5.8S ribosomal RNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #39 | Chains: L2,l2
60S ribosomal protein L2-A protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 292
95 % 2 97 392
90 % 2 99 397
70 % 2 174 278
50 % 2 187 277
40 % 47 258 200
30 % 47 258 210
Entity #4 | Chains: S2,s2
40S ribosomal protein S2 protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 51 581
95 % 2 51 785
90 % 2 51 819
70 % 2 59 761
50 % 2 66 732
40 % 2 66 760
30 % 2 66 800
Entity #40 | Chains: L3,l3
60S ribosomal protein L3 protein, length: 386 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 288
95 % 2 103 355
90 % 2 105 362
70 % 2 105 402
50 % 2 198 250
40 % 2 198 262
30 % 2 200 269
Entity #41 | Chains: L4,l4
60S ribosomal protein L4-A protein, length: 361 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 270
95 % 2 107 329
90 % 2 107 346
70 % 2 109 385
50 % 2 157 345
40 % 2 198 263
30 % 2 198 275
Entity #42 | Chains: L5,l5
60S ribosomal protein L5 protein, length: 296 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 93 316
95 % 2 95 405
90 % 2 95 421
70 % 2 97 442
50 % 2 183 290
40 % 2 185 292
30 % 2 185 311
Entity #43 | Chains: L6,l6
60S ribosomal protein L6-A protein, length: 175 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 298
95 % 2 102 356
90 % 2 103 369
70 % 2 106 393
50 % 2 107 444
40 % 2 111 456
30 % 2 111 474
Entity #44 | Chains: L7,l7
60S ribosomal protein L7-A protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 267
95 % 2 103 352
90 % 2 103 371
70 % 2 105 398
50 % 2 185 284
40 % 2 185 295
30 % 2 184 319
Entity #45 | Chains: L8,l8
60S ribosomal protein L8-A protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 319
95 % 2 106 350
90 % 2 106 375
70 % 2 108 397
50 % 2 169 328
40 % 2 171 333
30 % 2 171 350
Entity #46 | Chains: L9,l9
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 272
95 % 2 102 357
90 % 2 102 378
70 % 2 104 405
50 % 2 193 270
40 % 47 265 193
30 % 47 266 203
Entity #47 | Chains: M0,m0
60S ribosomal protein L10 protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 83 341
95 % 2 83 449
90 % 2 85 470
70 % 2 85 498
50 % 2 176 310
40 % 2 176 319
30 % 2 176 334
Entity #48 | Chains: M1,m1
60S ribosomal protein L11-B protein, length: 173 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 23 1157
95 % 2 98 385
90 % 2 100 392
70 % 3 186 257
50 % 3 190 271
40 % 3 190 283
30 % 3 190 298
Entity #49 | Chains: M3,m3
60S ribosomal protein L13-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 280
95 % 2 101 372
90 % 2 101 390
70 % 2 103 412
50 % 2 103 462
40 % 2 183 303
30 % 2 183 324
Entity #5 | Chains: S3,s3
40S ribosomal protein S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 72 387
95 % 3 72 505
90 % 3 72 534
70 % 3 84 503
50 % 3 168 323
40 % 3 168 332
30 % 3 168 349
Entity #50 | Chains: M4,m4
60S ribosomal protein L14-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 268
95 % 2 103 354
90 % 2 103 372
70 % 2 105 399
50 % 2 105 456
40 % 2 105 484
30 % 2 105 501
Entity #51 | Chains: M5,m5
60S ribosomal protein L15-A protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 262
95 % 2 108 328
90 % 2 108 345
70 % 2 183 265
50 % 2 197 256
40 % 2 197 267
30 % 2 197 281
Entity #52 | Chains: M6,m6
60S ribosomal protein L16-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 305
95 % 2 95 402
90 % 2 102 377
70 % 2 104 404
50 % 2 185 281
40 % 2 186 291
30 % 2 186 309
Entity #53 | Chains: M7,m7
60S ribosomal protein L17-A protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 256
95 % 2 106 334
90 % 2 108 340
70 % 2 108 389
50 % 2 195 259
40 % 2 195 272
30 % 2 195 285
Entity #54 | Chains: M8,m8
60S ribosomal protein L18-A protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 266
95 % 2 103 349
90 % 2 105 355
70 % 2 105 396
50 % 2 186 289
40 % 2 191 287
30 % 2 191 305
Entity #55 | Chains: M9,m9
60S ribosomal protein L19-A protein, length: 188 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 293
95 % 2 97 391
90 % 2 97 408
70 % 2 100 419
50 % 2 185 286
40 % 2 186 297
30 % 2 186 312
Entity #56 | Chains: N0,n0
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 283
95 % 2 101 377
90 % 2 103 382
70 % 2 103 414
50 % 2 176 319
40 % 2 177 320
30 % 2 178 332
Entity #57 | Chains: N1,n1
60S ribosomal protein L21-A protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 295
95 % 2 97 389
90 % 2 99 398
70 % 2 99 423
50 % 2 175 318
40 % 2 181 315
30 % 2 188 303
Entity #58 | Chains: N2,n2
60S ribosomal protein L22-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 456
95 % 2 72 597
90 % 2 72 629
70 % 2 73 650
50 % 2 73 683
40 % 2 73 715
30 % 2 74 717
Entity #59 | Chains: N3,n3
60S ribosomal protein L23-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 263
95 % 2 104 346
90 % 2 106 353
70 % 2 197 240
50 % 2 198 251
40 % 2 198 264
30 % 2 198 274
Entity #6 | Chains: S4,s4
40S ribosomal protein S4-A protein, length: 260 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 368
95 % 2 77 480
90 % 2 89 455
70 % 2 181 261
50 % 2 191 255
40 % 2 195 258
30 % 2 204 254
Entity #60 | Chains: N4,n4
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 64 477
95 % 2 66 627
90 % 2 66 654
70 % 2 67 680
50 % 2 67 720
40 % 2 114 489
30 % 2 114 511
Entity #61 | Chains: N5,n5
60S ribosomal protein L25 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 425
95 % 2 77 556
90 % 2 78 573
70 % 2 78 599
50 % 2 78 638
40 % 2 80 655
30 % 2 81 669
Entity #62 | Chains: N6,n6
60S ribosomal protein L26-A protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 108 249
95 % 2 108 324
90 % 2 110 335
70 % 2 110 381
50 % 2 193 266
40 % 2 193 278
30 % 2 193 291
Entity #63 | Chains: N7,n7
60S ribosomal protein L27-A protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 302
95 % 2 97 397
90 % 2 99 403
70 % 2 99 435
50 % 2 171 326
40 % 2 184 298
30 % 2 186 314
Entity #64 | Chains: N8,n8
60S ribosomal protein L28 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 309
95 % 2 98 387
90 % 2 100 393
70 % 2 100 418
50 % 2 188 275
40 % 2 189 284
30 % 2 191 296
Entity #65 | Chains: N9,n9
60S ribosomal protein L29 protein, length: 58 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 89 329
95 % 2 89 432
90 % 2 91 440
70 % 2 91 466
50 % 2 91 505
40 % 2 91 540
30 % 2 91 566
Entity #66 | Chains: O0,o0
60S ribosomal protein L30 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 103 261
95 % 3 103 341
90 % 3 105 351
70 % 3 105 392
50 % 3 146 363
40 % 3 146 374
30 % 3 146 388
Entity #67 | Chains: O1,o1
60S ribosomal protein L31-A protein, length: 112 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 276
95 % 2 101 364
90 % 2 101 385
70 % 2 103 410
50 % 2 185 283
40 % 2 185 296
30 % 2 185 316
Entity #68 | Chains: O2,o2
60S ribosomal protein L32 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 265
95 % 2 104 348
90 % 2 104 368
70 % 2 106 395
50 % 2 189 274
40 % 2 193 279
30 % 2 194 287
Entity #69 | Chains: O3,o3
60S ribosomal protein L33-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 274
95 % 2 102 362
90 % 2 102 383
70 % 2 104 408
50 % 2 181 308
40 % 2 183 311
30 % 2 183 328
Entity #7 | Chains: S5,s5
40S ribosomal protein S5 protein, length: 224 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 361
95 % 2 79 462
90 % 2 91 432
70 % 2 91 462
50 % 2 201 234
40 % 2 201 244
30 % 2 201 258
Entity #70 | Chains: O4,o4
60S ribosomal protein L34-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 300
95 % 2 97 400
90 % 2 97 412
70 % 2 99 430
50 % 2 170 329
40 % 2 170 335
30 % 2 170 354
Entity #71 | Chains: O5,o5
60S ribosomal protein L35-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 253
95 % 2 107 330
90 % 2 107 347
70 % 2 109 387
50 % 2 188 282
40 % 2 199 261
30 % 2 201 268
Entity #72 | Chains: O6,o6
60S ribosomal protein L36-A protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 294
95 % 2 102 365
90 % 2 102 386
70 % 2 104 411
50 % 2 104 461
40 % 2 178 316
30 % 2 178 331
Entity #73 | Chains: O7,o7
60S ribosomal protein L37-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 264
95 % 2 104 343
90 % 2 104 366
70 % 2 148 306
50 % 2 193 264
40 % 2 193 276
30 % 2 193 289
Entity #74 | Chains: O8,o8
60S ribosomal protein L38 protein, length: 77 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 303
95 % 2 97 401
90 % 2 97 416
70 % 2 99 437
50 % 2 99 484
40 % 2 106 472
30 % 2 106 493
Entity #75 | Chains: O9,o9
60S ribosomal protein L39 protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 278
95 % 2 101 363
90 % 2 101 384
70 % 2 176 276
50 % 2 189 273
40 % 2 191 282
30 % 2 192 294
Entity #76 | Chains: Q0,q0
Ubiquitin-60S ribosomal protein L40 protein, length: 52 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 49 543
95 % 1 50 730
90 % 1 50 766
70 % 1 96 467
50 % 1 96 506
40 % 1 96 541
30 % 1 96 567
Entity #77 | Chains: Q1,q1
60S ribosomal protein L41-A protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 81 346
95 % 2 81 460
90 % 2 81 490
70 % 2 163 284
50 % 2 163 334
40 % 2 163 344
30 % 2 163 361
Entity #78 | Chains: Q2,q2
60S ribosomal protein L42-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 307
95 % 2 94 408
90 % 2 96 410
70 % 2 174 279
50 % 2 181 298
40 % 2 182 306
30 % 2 182 326
Entity #79 | Chains: Q3,q3
60S ribosomal protein L43-A protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 308
95 % 2 94 406
90 % 2 94 422
70 % 2 96 444
50 % 2 184 285
40 % 2 185 293
30 % 23 208 256
Entity #8 | Chains: S6,s6
40S ribosomal protein S6-A protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 374
95 % 2 77 485
90 % 2 77 509
70 % 2 89 489
50 % 2 182 296
40 % 2 187 289
30 % 2 187 306
Entity #80 | Chains: e0
40S ribosomal protein S30-A protein, length: 62 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 95 370
95 % 3 95 481
90 % 3 107 456
70 % 3 107 484
50 % 3 171 360
40 % 3 171 371
30 % 3 171 385
Entity #81 | Chains: m2
Unknown protein m2 protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #82 | Chains: p0
60S acidic ribosomal protein P0 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 54937
95 % 1 43 1535
90 % 2 47 1454
70 % 2 48 1448
50 % 2 69 1016
40 % 2 69 1043
30 % 2 69 1093
Entity #83 | Chains: p1
Unknown protein p1 protein, length: 47 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #84 | Chains: p2
Unknown protein p2 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #9 | Chains: S7,s7
40S ribosomal protein S7-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 372
95 % 2 76 483
90 % 2 88 460
70 % 2 88 485
50 % 2 188 272
40 % 2 188 285
30 % 2 191 282


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 14 AM, CM 40S ribosomal protein S12 4932
2 4U4R 14 C2, c2 40S ribosomal protein S12 4932
3 4U3U 14 C2, c2 40S ribosomal protein S12 4932
4 5TBW 61 N, c2 40S ribosomal protein S12 4932
5 4U3M 14 C2, c2 40S ribosomal protein S12 4932
6 4U3N 14 C2, c2 40S ribosomal protein S12 4932
7 4U52 14 C2, c2 40S ribosomal protein S12 4932
8 4U4Q 14 C2, c2 40S ribosomal protein S12 4932
9 4U6F 14 C2, c2 40S ribosomal protein S12 4932
10 4U4U 14 C2, c2 40S ribosomal protein S12 4932
11 4U4Z 14 C2, c2 40S ribosomal protein S12 4932
12 4U4Y 14 C2, c2 40S ribosomal protein S12 4932
13 4U4N 14 C2, c2 40S ribosomal protein S12 4932
14 4U55 14 C2, c2 40S ribosomal protein S12 4932
15 5DAT 14 C2, c2 40S ribosomal protein S12 4932
16 5I4L 14 C2, c2 40S ribosomal protein S12 4932
17 4U51 14 C2, c2 40S ribosomal protein S12 4932
18 6HHQ 60 N, c2 40S ribosomal protein S12 4932
19 5OBM 58 C2, c2 40S ribosomal protein S12 4932
20 4U53 14 C2, c2 40S ribosomal protein S12 4932
21 5ON6 62 N, c2 40S ribosomal protein S12 4932
22 4U50 14 C2, c2 40S ribosomal protein S12 4932
23 5NDV 58 C2, c2 40S ribosomal protein S12 4932
24 5LYB 14 C2 40S Ribosomal Protein S12 4932
25 5LYB 81 c2 40S Ribosomal Protein S12 4932
26 4U56 14 C2, c2 40S ribosomal protein S12 4932
27 5TGA 14 C2, c2 40S ribosomal protein S12 4932
28 5MEI 61 N, c2 40S ribosomal protein S12 4932
29 5FCJ 14 C2, c2 40S ribosomal protein S12 (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SDVEEVVEVQEETVVEQTAEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVTEANIIKLVEGLAND PENKVPLIKVADAKQLGEWAGLAKIDREANARKVVGASVVVVKNWGAETDELSMIMEHFSQQ 4932
30 4U4O 14 C2, c2 40S ribosomal protein S12 4932
31 5DGV 14 C2, c2 40S ribosomal protein S12 4932
32 5DGE 14 C2, c2 40S ribosomal protein S12 4932
33 5NDW 7 C2, c2 40S ribosomal protein S12 4932
34 5NDG 14 C2, c2 40S ribosomal protein S12 4932
35 5FCI 14 C2, c2 40S ribosomal protein S12 (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SDVEEVVEVQEETVVEQTAEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVTEANIIKLVEGLAND PENKVPLIKVADAKQLGEWAGLAKIDREANARKVVGASVVVVKNWGAETDELSMIMEHFSQQ 4932
36 5DC3 14 C2, c2 40S ribosomal protein S12 4932
37 5DGF 14 C2, c2 40S ribosomal protein S12 4932
38 5TGM 14 C2, c2 40S Ribosomal Protein S12,40S ribosomal protein S12 4932
39 6Y7C 12 M 40S ribosomal protein S12 4932
40 6TNU 16 D 40S ribosomal protein S12 4932
41 6UZ7 60 M 40S ribosomal protein S12 28985
42 6TB3 16 D 40S ribosomal protein S12 4932
43 6T83 15 Mb, n 40S ribosomal protein S12 4932
44 6T7T 17 SM 40S ribosomal protein S12 4932
45 6T7I 15 SM 40S ribosomal protein S12 4932
46 6T4Q 14 SM 40S ribosomal protein S12 4932
47 6SV4 31 D, Db, Dc 40S ribosomal protein S12 4932
48 6SNT 15 M 40S ribosomal protein S12 4932
49 6S47 58 BN 40S ribosomal protein S12 4932
50 6OKK 18 R 40S ribosomal protein S12 5833
51 6RBD 26 M 40S ribosomal protein S12 4932
52 6RBE 24 M 40S ribosomal protein S12 4932
53 6Q8Y 60 D 40S ribosomal protein S12 4932
54 6I7O 31 D, Db 40S ribosomal protein S12 4932
55 6GSM 16 M 40S ribosomal protein S12 28985
56 6GSN 6 M 40S ribosomal protein S12 28985
57 6GQV 60 AC 40S ribosomal protein S12 4932
58 6GQ1 60 AC 40S ribosomal protein S12 4932
59 6GQB 60 AC 40S ribosomal protein S12 4932
60 6FYX 16 M 40S ribosomal protein S12 28985
61 6FYY 16 M 40S ribosomal protein S12 28985
62 6FAI 23 M 40S ribosomal protein S12 4932
63 6EML 2 D 40S ribosomal protein S12 4932
64 5XXU 14 M Ribosomal protein eS12 5811
65 5WYJ 43 SN 40S ribosomal protein S12 4932
66 5MC6 5 D 40S ribosomal protein S12 4932
67 5M1J 20 M2 40S ribosomal protein S12 4932
68 5JUO 62 JB eS12 (yeast S12) 4932
69 5JUP 62 JB eS12 (yeast S12) 4932
70 5JUS 62 JB eS12 (yeast S12) 4932
71 5JUT 62 JB eS12 (yeast S12) 4932
72 5JUU 62 JB eS12 (yeast S12) 4932
73 5IT7 60 M 40S ribosomal protein S12 28985
74 5IT9 13 M Ribosomal protein eS12 28985
75 3JAP 16 M eS12 28985
76 3JAQ 16 M eS12 28985
77 3JAM 14 M eS12 28985
78 4UER 31 U ES12 4934
79 3J81 14 M eS12 28985
80 3J80 23 M eS12 28985
81 3J7A 18 R 40S ribosomal protein eS12 5833
82 3J77 58 12 40S ribosomal protein S12 4932
83 3J78 58 12 40S ribosomal protein S12 4932
84 3J6X 59 12 40S ribosomal protein S12 4932
85 3J6Y 59 12 40S ribosomal protein S12 4932
86 4V92 15 BM ES12 28985
87 4V8Y 21 AM 40S RIBOSOMAL PROTEIN S12 4932
88 4V8Z 21 AM 40S RIBOSOMAL PROTEIN S12 4932