
Crystal structure of Lactimidomycin bound to the yeast 80S ribosome

Sequence Similarity Clusters for the Entities in PDB 4U4R

Entity #1 | Chains: 2,6
18S ribosomal RNA rna, length: 1800 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: S8,s8
40S ribosomal protein S8-A protein, length: 200 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 90 366
95 % 2 90 464
90 % 2 96 453
70 % 2 113 413
50 % 2 227 236
40 % 2 231 237
30 % 2 231 244
Entity #11 | Chains: S9,s9
40S ribosomal protein S9-A protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 317
95 % 2 101 406
90 % 2 113 358
70 % 2 223 234
50 % 2 238 223
40 % 2 249 217
30 % 2 249 223
Entity #12 | Chains: C0,c0
40S ribosomal protein S10-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 20 1549
95 % 2 71 622
90 % 2 74 602
70 % 2 90 523
50 % 2 90 554
40 % 2 90 593
30 % 2 90 619
Entity #13 | Chains: C1,c1
40S ribosomal protein S11-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 328
95 % 2 98 422
90 % 2 110 384
70 % 2 115 396
50 % 2 234 232
40 % 2 234 233
30 % 2 234 241
Entity #14 | Chains: C2,c2
40S ribosomal protein S12 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 38 1072
95 % 2 56 760
90 % 2 58 746
70 % 2 92 495
50 % 2 92 530
40 % 2 95 552
30 % 2 95 581
Entity #15 | Chains: C3,c3
40S ribosomal protein S13 protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 329
95 % 2 98 425
90 % 2 110 383
70 % 2 232 227
50 % 2 235 231
40 % 2 247 218
30 % 2 247 224
Entity #16 | Chains: C4,c4
40S ribosomal protein S14-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 504
95 % 2 112 351
90 % 2 112 371
70 % 2 236 218
50 % 2 237 226
40 % 2 237 228
30 % 2 237 235
Entity #17 | Chains: C5,c5
40S ribosomal protein S15 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 62 535
95 % 2 72 534
90 % 2 72 560
70 % 2 91 489
50 % 2 201 284
40 % 2 212 268
30 % 2 212 280
Entity #18 | Chains: C6,c6
40S ribosomal protein S16-A protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 100 314
95 % 2 112 352
90 % 2 113 365
70 % 2 113 412
50 % 2 228 234
40 % 2 239 227
30 % 2 240 230
Entity #19 | Chains: C7,c7
40S ribosomal protein S17-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 409
95 % 2 76 525
90 % 2 88 492
70 % 2 88 518
50 % 2 202 276
40 % 2 202 283
30 % 2 202 297
Entity #2 | Chains: S0,s0
40S ribosomal protein S0-A protein, length: 251 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 52 622
95 % 2 55 779
90 % 2 55 808
70 % 2 63 756
50 % 2 72 712
40 % 2 141 397
30 % 2 141 412
Entity #20 | Chains: C8,c8
40S ribosomal protein S18-A protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 89 360
95 % 2 90 453
90 % 2 102 425
70 % 2 215 241
50 % 2 224 239
40 % 2 236 230
30 % 2 237 237
Entity #21 | Chains: C9,c9
40S ribosomal protein S19-A protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 84 374
95 % 2 84 475
90 % 2 84 496
70 % 2 96 470
50 % 2 97 502
40 % 2 201 291
30 % 2 204 284
Entity #22 | Chains: D0,d0
40S ribosomal protein S20 protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 384
95 % 2 80 492
90 % 2 80 512
70 % 2 92 482
50 % 2 92 523
40 % 2 94 527
30 % 2 94 557
Entity #23 | Chains: D1,d1
40S ribosomal protein S21-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 398
95 % 2 79 503
90 % 2 91 472
70 % 2 91 496
50 % 2 200 287
40 % 2 200 298
30 % 2 200 310
Entity #24 | Chains: D2,d2
40S ribosomal protein S22-A protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 92 351
95 % 2 114 341
90 % 2 114 360
70 % 2 238 220
50 % 2 240 222
40 % 3 252 213
30 % 38 896 20
Entity #25 | Chains: D3,d3
40S ribosomal protein S23-A protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 325
95 % 2 111 357
90 % 2 111 378
70 % 2 242 211
50 % 2 255 204
40 % 2 255 210
30 % 2 255 220
Entity #26 | Chains: D4,d4
40S ribosomal protein S24-A protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 332
95 % 2 98 426
90 % 2 110 389
70 % 2 115 401
50 % 2 229 238
40 % 2 229 240
30 % 2 229 250
Entity #27 | Chains: D5,d5
40S ribosomal protein S25-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 56 583
95 % 2 56 765
90 % 2 56 798
70 % 2 64 747
50 % 2 64 781
40 % 2 64 806
30 % 2 66 836
Entity #28 | Chains: D6,d6
40S ribosomal protein S26-B protein, length: 97 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 49 598
95 % 1 49 784
90 % 1 53 773
70 % 1 53 798
50 % 1 91 550
40 % 1 91 587
30 % 1 91 613
Entity #29 | Chains: D7,d7
40S ribosomal protein S27-A protein, length: 81 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 348
95 % 2 106 388
90 % 2 106 411
70 % 2 212 244
50 % 2 224 241
40 % 2 224 243
30 % 2 224 251
Entity #3 | Chains: S1,s1
40S ribosomal protein S1-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 91 355
95 % 2 93 444
90 % 2 103 426
70 % 2 110 424
50 % 2 116 440
40 % 2 197 293
30 % 2 197 307
Entity #30 | Chains: D8,d8
40S ribosomal protein S28-A protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 92 361
95 % 2 111 354
90 % 2 111 374
70 % 2 229 229
50 % 2 243 214
40 % 2 244 219
30 % 2 244 226
Entity #31 | Chains: D9,d9
40S ribosomal protein S29-A protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 392
95 % 2 78 500
90 % 2 79 517
70 % 2 192 266
50 % 2 200 286
40 % 2 200 295
30 % 2 200 305
Entity #32 | Chains: E0
40S ribosomal protein S30-A protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 383
95 % 2 99 493
90 % 2 111 466
70 % 2 111 487
50 % 2 191 337
40 % 2 191 351
30 % 2 191 368
Entity #33 | Chains: E1,e1
Ubiquitin-40S ribosomal protein S31 protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 39 807
95 % 1 44 973
90 % 1 44 1005
70 % 1 83 605
50 % 1 87 615
40 % 1 87 660
30 % 1 87 682
Entity #34 | Chains: SR,sR
Guanine nucleotide-binding protein subunit beta-like protein protein, length: 318 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 76 402
95 % 3 83 462
90 % 3 83 480
70 % 3 83 504
50 % 5 199 268
40 % 5 205 256
30 % 5 206 266
Entity #35 | Chains: SM,sM
Suppressor protein STM1 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1105
95 % 1 27 1425
90 % 1 27 1472
70 % 3 33 1296
50 % 3 33 1328
40 % 3 33 1362
30 % 3 33 1401
Entity #36 | Chains: 1,5
25S ribosomal RNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #37 | Chains: 3,7
5S ribosomal RNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #38 | Chains: 4,8
5.8S ribosomal RNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #39 | Chains: L2,l2
60S ribosomal protein L2-A protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 300
95 % 2 106 382
90 % 2 108 397
70 % 2 195 268
50 % 2 208 267
40 % 47 282 196
30 % 47 282 206
Entity #4 | Chains: S2,s2
40S ribosomal protein S2 protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 55 595
95 % 2 55 774
90 % 2 55 803
70 % 2 63 761
50 % 2 70 735
40 % 2 70 762
30 % 2 70 805
Entity #40 | Chains: L3,l3
60S ribosomal protein L3 protein, length: 386 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 288
95 % 2 113 345
90 % 2 115 352
70 % 2 115 395
50 % 2 220 251
40 % 2 220 253
30 % 2 222 260
Entity #41 | Chains: L4,l4
60S ribosomal protein L4-A protein, length: 361 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 273
95 % 2 117 327
90 % 2 117 346
70 % 2 119 379
50 % 2 167 341
40 % 2 220 254
30 % 2 220 264
Entity #42 | Chains: L5,l5
60S ribosomal protein L5 protein, length: 296 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 312
95 % 2 103 400
90 % 2 103 420
70 % 2 105 440
50 % 2 203 283
40 % 2 205 284
30 % 2 205 298
Entity #43 | Chains: L6,l6
60S ribosomal protein L6-A protein, length: 175 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 292
95 % 2 112 350
90 % 2 113 362
70 % 2 116 390
50 % 2 117 434
40 % 2 121 449
30 % 2 121 464
Entity #44 | Chains: L7,l7
60S ribosomal protein L7-A protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 272
95 % 2 113 344
90 % 2 113 363
70 % 2 115 394
50 % 2 207 273
40 % 2 207 279
30 % 2 206 296
Entity #45 | Chains: L8,l8
60S ribosomal protein L8-A protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 109 311
95 % 2 116 347
90 % 2 116 361
70 % 2 118 393
50 % 2 191 308
40 % 2 193 317
30 % 2 193 332
Entity #46 | Chains: L9,l9
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 279
95 % 2 112 348
90 % 2 112 368
70 % 2 114 403
50 % 2 215 263
40 % 2 216 260
30 % 2 218 270
Entity #47 | Chains: M0,m0
60S ribosomal protein L10 protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 88 365
95 % 2 88 460
90 % 2 90 467
70 % 2 90 488
50 % 2 190 304
40 % 2 190 316
30 % 2 190 328
Entity #48 | Chains: M1,m1
60S ribosomal protein L11-B protein, length: 173 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 25 1143
95 % 2 106 385
90 % 2 108 401
70 % 3 206 252
50 % 3 210 266
40 % 3 210 271
30 % 3 210 283
Entity #49 | Chains: M3,m3
60S ribosomal protein L13-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 286
95 % 2 111 366
90 % 2 111 387
70 % 2 113 416
50 % 2 113 462
40 % 2 205 288
30 % 2 205 300
Entity #5 | Chains: S3,s3
40S ribosomal protein S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 78 388
95 % 3 78 494
90 % 3 78 519
70 % 3 90 491
50 % 3 191 302
40 % 3 191 314
30 % 3 191 325
Entity #50 | Chains: M4,m4
60S ribosomal protein L14-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 276
95 % 2 113 342
90 % 2 113 364
70 % 2 115 398
50 % 2 115 453
40 % 2 115 473
30 % 2 115 496
Entity #51 | Chains: M5,m5
60S ribosomal protein L15-A protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 115 264
95 % 2 118 325
90 % 2 118 345
70 % 2 205 255
50 % 2 219 253
40 % 2 219 255
30 % 2 219 269
Entity #52 | Chains: M6,m6
60S ribosomal protein L16-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 303
95 % 2 105 390
90 % 2 112 369
70 % 2 114 402
50 % 2 207 270
40 % 2 208 275
30 % 2 208 291
Entity #53 | Chains: M7,m7
60S ribosomal protein L17-A protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 116 260
95 % 2 116 330
90 % 2 118 343
70 % 2 118 383
50 % 2 217 254
40 % 2 217 258
30 % 2 217 272
Entity #54 | Chains: M8,m8
60S ribosomal protein L18-A protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 274
95 % 2 113 346
90 % 2 115 355
70 % 2 115 397
50 % 2 208 278
40 % 2 213 273
30 % 2 213 286
Entity #55 | Chains: M9,m9
60S ribosomal protein L19-A protein, length: 188 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 294
95 % 2 107 378
90 % 2 107 405
70 % 2 110 423
50 % 2 207 275
40 % 2 208 277
30 % 2 208 295
Entity #56 | Chains: N0,n0
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 285
95 % 2 111 365
90 % 2 113 372
70 % 2 113 415
50 % 2 198 299
40 % 2 199 304
30 % 2 200 314
Entity #57 | Chains: N1,n1
60S ribosomal protein L21-A protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 293
95 % 2 107 377
90 % 2 109 391
70 % 2 109 425
50 % 2 197 301
40 % 2 203 301
30 % 2 210 287
Entity #58 | Chains: N2,n2
60S ribosomal protein L22-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 81 432
95 % 2 81 548
90 % 2 81 576
70 % 2 82 590
50 % 2 82 635
40 % 2 82 677
30 % 2 83 677
Entity #59 | Chains: N3,n3
60S ribosomal protein L23-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 262
95 % 2 114 335
90 % 2 116 349
70 % 2 219 240
50 % 2 225 248
40 % 2 225 249
30 % 5 232 247
Entity #6 | Chains: S4,s4
40S ribosomal protein S4-A protein, length: 260 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 334
95 % 2 97 429
90 % 2 109 396
70 % 2 218 239
50 % 2 228 235
40 % 2 232 236
30 % 2 244 227
Entity #60 | Chains: N4,n4
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 68 503
95 % 2 70 639
90 % 2 70 667
70 % 2 71 685
50 % 2 71 718
40 % 2 128 468
30 % 2 128 489
Entity #61 | Chains: N5,n5
60S ribosomal protein L25 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 86 406
95 % 2 86 518
90 % 2 87 537
70 % 2 87 564
50 % 2 87 595
40 % 2 89 628
30 % 2 90 646
Entity #62 | Chains: N6,n6
60S ribosomal protein L26-A protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 118 253
95 % 2 118 321
90 % 2 120 332
70 % 2 120 373
50 % 2 215 257
40 % 2 215 263
30 % 2 215 277
Entity #63 | Chains: N7,n7
60S ribosomal protein L27-A protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 298
95 % 2 107 383
90 % 2 109 398
70 % 2 109 431
50 % 2 193 306
40 % 2 206 285
30 % 2 208 294
Entity #64 | Chains: N8,n8
60S ribosomal protein L28 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 304
95 % 2 108 368
90 % 2 110 382
70 % 2 110 420
50 % 2 210 265
40 % 2 211 270
30 % 2 216 274
Entity #65 | Chains: N9,n9
60S ribosomal protein L29 protein, length: 58 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 345
95 % 2 94 441
90 % 2 96 456
70 % 2 96 474
50 % 2 96 518
40 % 2 96 542
30 % 2 96 574
Entity #66 | Chains: O0,o0
60S ribosomal protein L30 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 113 267
95 % 3 113 337
90 % 3 115 351
70 % 3 115 386
50 % 3 156 363
40 % 3 156 379
30 % 3 156 391
Entity #67 | Chains: O1,o1
60S ribosomal protein L31-A protein, length: 112 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 280
95 % 2 111 353
90 % 2 111 375
70 % 2 113 409
50 % 2 207 271
40 % 2 207 278
30 % 2 207 293
Entity #68 | Chains: O2,o2
60S ribosomal protein L32 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 270
95 % 2 114 338
90 % 2 114 356
70 % 2 116 389
50 % 2 211 264
40 % 2 215 261
30 % 2 216 275
Entity #69 | Chains: O3,o3
60S ribosomal protein L33-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 112 283
95 % 2 112 360
90 % 2 112 381
70 % 2 114 411
50 % 2 203 291
40 % 2 205 297
30 % 2 206 306
Entity #7 | Chains: S5,s5
40S ribosomal protein S5 protein, length: 224 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 323
95 % 2 100 409
90 % 2 112 367
70 % 2 112 414
50 % 2 239 219
40 % 2 239 225
30 % 2 239 233
Entity #70 | Chains: O4,o4
60S ribosomal protein L34-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 299
95 % 2 107 384
90 % 2 107 409
70 % 2 109 433
50 % 2 192 307
40 % 2 192 318
30 % 2 192 336
Entity #71 | Chains: O5,o5
60S ribosomal protein L35-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 117 258
95 % 2 117 324
90 % 2 117 344
70 % 2 119 378
50 % 2 210 272
40 % 2 221 252
30 % 2 223 259
Entity #72 | Chains: O6,o6
60S ribosomal protein L36-A protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 108 295
95 % 2 112 358
90 % 2 112 373
70 % 2 114 407
50 % 2 114 461
40 % 2 200 302
30 % 2 210 290
Entity #73 | Chains: O7,o7
60S ribosomal protein L37-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 263
95 % 2 114 336
90 % 2 114 357
70 % 2 170 296
50 % 2 215 256
40 % 2 215 262
30 % 2 215 276
Entity #74 | Chains: O8,o8
60S ribosomal protein L38 protein, length: 77 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 297
95 % 2 107 381
90 % 2 107 408
70 % 2 109 428
50 % 2 109 470
40 % 2 116 463
30 % 2 116 481
Entity #75 | Chains: O9,o9
60S ribosomal protein L39 protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 282
95 % 2 111 356
90 % 2 111 377
70 % 2 198 265
50 % 2 216 255
40 % 2 216 259
30 % 2 217 273
Entity #76 | Chains: Q0,q0
Ubiquitin-60S ribosomal protein L40 protein, length: 52 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 50 582
95 % 1 51 757
90 % 1 51 793
70 % 1 97 484
50 % 1 97 524
40 % 1 97 560
30 % 1 97 590
Entity #77 | Chains: Q1,q1
60S ribosomal protein L41-A protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 86 371
95 % 2 86 470
90 % 2 86 491
70 % 2 183 277
50 % 2 183 314
40 % 2 183 324
30 % 2 183 343
Entity #78 | Chains: Q2,q2
60S ribosomal protein L42-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 319
95 % 2 99 417
90 % 2 101 431
70 % 2 194 269
50 % 2 201 288
40 % 2 202 296
30 % 2 202 309
Entity #79 | Chains: Q3,q3
60S ribosomal protein L43-A protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 306
95 % 2 103 399
90 % 2 103 421
70 % 2 105 441
50 % 2 205 277
40 % 2 206 282
30 % 23 229 253
Entity #8 | Chains: S6,s6
40S ribosomal protein S6-A protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 96 342
95 % 2 97 436
90 % 2 97 454
70 % 2 109 435
50 % 2 219 252
40 % 2 224 250
30 % 2 224 258
Entity #80 | Chains: e0
40S ribosomal protein S30-A protein, length: 62 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 99 383
95 % 3 99 493
90 % 3 111 466
70 % 3 111 487
50 % 3 191 337
40 % 3 191 351
30 % 3 191 368
Entity #81 | Chains: m2
Unknown protein m2 protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #82 | Chains: p0
60S acidic ribosomal protein P0 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 55421
95 % 1 44 1555
90 % 2 48 1453
70 % 2 49 1455
50 % 2 74 979
40 % 2 74 1002
30 % 2 74 1049
Entity #83 | Chains: p1
Unknown protein p1 protein, length: 47 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #84 | Chains: p2
Unknown protein p2 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #9 | Chains: S7,s7
40S ribosomal protein S7-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 96 340
95 % 2 96 437
90 % 2 108 406
70 % 2 108 436
50 % 2 226 243
40 % 2 226 245
30 % 2 229 246


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
34 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
35 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
36 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
37 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
39 6ZVI 37 w 40S ribosomal protein S14-B 4932
40 6ZQA 48 DO 40S ribosomal protein S14-A 4932
41 6ZQB 57 DO 40S ribosomal protein S14-A 4932
42 6ZQC 57 DO 40S ribosomal protein S14-A 4932
43 6ZQD 53 DO 40S ribosomal protein S14-A 4932
44 6ZQE 49 DO 40S ribosomal protein S14-A 4932
45 6ZQF 35 DO 40S ribosomal protein S14-A 4932
46 6ZQG 27 DO 40S ribosomal protein S14-A 4932
47 6XIQ 61 AE 40S ribosomal protein S14-B 4932
48 6XIR 58 AE 40S ribosomal protein S14-B 4932
49 6Z6J 20 SO 40S ribosomal protein S14-A 4932
50 6Z6K 20 SO 40S ribosomal protein S14-A 4932
51 6WOO 62 OO uS11 4932
52 6Y7C 14 O 40S ribosomal protein S14-A 4932
53 6LQP 14 SP 40S ribosomal protein S14-A 4932
54 6LQQ 13 SP 40S ribosomal protein S14-A 4932
55 6LQR 13 SP 40S ribosomal protein S14-A 4932
56 6LQS 13 SP 40S ribosomal protein S14-A 4932
57 6LQT 13 SP 40S ribosomal protein S14-A 4932
58 6LQU 13 SP 40S ribosomal protein S14-A 4932
59 6TNU 18 Z 40S ribosomal protein S14-B 4932
60 6UZ7 62 O 40S ribosomal protein S14 28985
61 6TB3 18 Z 40S ribosomal protein S14-B 4932
62 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
63 6T7T 19 SO 40S ribosomal protein S14-B 4932
64 6T7I 17 SO 40S ribosomal protein S14-A 4932
65 6T4Q 16 SO 40S ribosomal protein S14-B 4932
66 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
67 6SNT 17 O 40S ribosomal protein S14-A 4932
68 6KE6 14 SP 40S ribosomal protein S14-A 4932
69 6S47 60 BP 40S ribosomal protein S14-A 4932
70 6RBD 27 O 40S ribosomal protein S14-A 4932
71 6RBE 12 O 40S ribosomal protein S14-A 4932
72 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
73 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
74 6GSM 18 O 40S ribosomal protein S14 28985
75 6GSN 38 O 40S ribosomal protein S14 28985
76 6GQV 62 AE 40S ribosomal protein S14-B 4932
77 6GQ1 62 AE 40S ribosomal protein S14-B 4932
78 6GQB 62 AE 40S ribosomal protein S14-B 4932
79 6FYX 18 O 40S ribosomal protein S14 28985
80 6FYY 18 O 40S ribosomal protein S14 28985
81 6FAI 25 O 40S ribosomal protein S14-A 4932
82 6EML 22 Z 40S ribosomal protein S14-A 4932
83 5WLC 40 NG rpS14_uS11 4932
84 5WYJ 45 SP 40S ribosomal protein S14-A 4932
85 5WYK 41 SP 40S ribosomal protein S14-A 4932
86 5MC6 27 Z 40S ribosomal protein S14-A 4932
87 5M1J 22 O2 40S ribosomal protein S14-A 4932
88 5LL6 12 Z 40S ribosomal protein S14-A 4932
89 5JUO 64 LB uS11 (yeast S14) 4932
90 5JUP 64 LB uS11 (yeast S14) 4932
91 5JUS 64 LB uS11 (yeast S14) 4932
92 5JUT 64 LB uS11 (yeast S14) 4932
93 5JUU 64 LB uS11 (yeast S14) 4932
94 5JPQ 29 w uS11 209285
95 5IT7 62 O 40S ribosomal protein S14 28985
96 5IT9 15 O Ribosomal protein uS14 28985
97 3JAP 18 O uS11 28985
98 3JAQ 18 O uS11 28985
99 3JAM 16 O uS11 28985
100 4UER 21 K US11 4934
101 3J81 16 O uS11 28985
102 3J80 12 O uS11 28985
103 3J77 60 14 40S ribosomal protein S14 4932
104 3J78 60 14 40S ribosomal protein S14 4932
105 3J6X 61 14 40S ribosomal protein S14 4932
106 3J6Y 61 14 40S ribosomal protein S14 4932
107 4V92 17 BO US11 28985
108 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
109 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
110 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
111 4V7H 10 AK 40S ribosomal protein S14(A) 5541
112 4V4B 11 AK 40S ribosomal protein S14-A 4932