4U4R

Crystal structure of Lactimidomycin bound to the yeast 80S ribosome


Sequence Similarity Clusters for the Entities in PDB 4U4R

Entity #1 | Chains: 2,6
18S ribosomal RNA rna, length: 1800 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: S8,s8
40S ribosomal protein S8-A protein, length: 200 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 413
95 % 2 70 529
90 % 2 76 512
70 % 2 93 461
50 % 2 191 256
40 % 2 195 257
30 % 2 195 273
Entity #11 | Chains: S9,s9
40S ribosomal protein S9-A protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 351
95 % 2 80 459
90 % 2 92 432
70 % 2 186 251
50 % 2 201 235
40 % 2 209 235
30 % 2 209 247
Entity #12 | Chains: C0,c0
40S ribosomal protein S10-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 19 1561
95 % 2 65 620
90 % 2 68 627
70 % 2 84 536
50 % 2 84 567
40 % 2 84 607
30 % 2 84 624
Entity #13 | Chains: C1,c1
40S ribosomal protein S11-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 364
95 % 2 78 473
90 % 2 90 437
70 % 2 95 449
50 % 2 198 240
40 % 2 198 249
30 % 2 198 264
Entity #14 | Chains: C2,c2
40S ribosomal protein S12 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 33 1144
95 % 2 51 775
90 % 2 53 776
70 % 2 85 505
50 % 2 85 533
40 % 2 88 560
30 % 2 88 586
Entity #15 | Chains: C3,c3
40S ribosomal protein S13 protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 356
95 % 2 78 465
90 % 2 90 442
70 % 2 195 241
50 % 2 198 242
40 % 2 206 238
30 % 2 207 249
Entity #16 | Chains: C4,c4
40S ribosomal protein S14-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 350
95 % 2 92 414
90 % 2 92 429
70 % 2 199 228
50 % 2 200 237
40 % 2 200 248
30 % 2 200 262
Entity #17 | Chains: C5,c5
40S ribosomal protein S15 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 58 536
95 % 2 68 546
90 % 2 68 574
70 % 2 86 499
50 % 2 181 294
40 % 2 189 287
30 % 2 189 304
Entity #18 | Chains: C6,c6
40S ribosomal protein S16-A protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 353
95 % 2 91 416
90 % 2 92 430
70 % 2 92 462
50 % 2 192 250
40 % 2 200 247
30 % 2 201 261
Entity #19 | Chains: C7,c7
40S ribosomal protein S17-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 420
95 % 2 70 531
90 % 2 82 492
70 % 2 82 519
50 % 2 178 295
40 % 2 178 306
30 % 2 178 330
Entity #2 | Chains: S0,s0
40S ribosomal protein S0-A protein, length: 251 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 610
95 % 2 51 787
90 % 2 51 824
70 % 2 59 771
50 % 2 68 712
40 % 2 133 405
30 % 2 133 418
Entity #20 | Chains: C8,c8
40S ribosomal protein S18-A protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 376
95 % 2 76 477
90 % 2 88 453
70 % 2 185 252
50 % 2 194 246
40 % 2 204 241
30 % 2 204 252
Entity #21 | Chains: C9,c9
40S ribosomal protein S19-A protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 74 382
95 % 2 74 495
90 % 2 74 521
70 % 2 86 496
50 % 2 176 304
40 % 2 176 316
30 % 2 180 314
Entity #22 | Chains: D0,d0
40S ribosomal protein S20 protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 384
95 % 2 74 490
90 % 2 74 516
70 % 2 86 491
50 % 2 86 525
40 % 2 88 539
30 % 2 88 566
Entity #23 | Chains: D1,d1
40S ribosomal protein S21-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 389
95 % 2 73 501
90 % 2 85 473
70 % 2 85 501
50 % 2 172 315
40 % 2 172 328
30 % 2 172 346
Entity #24 | Chains: D2,d2
40S ribosomal protein S22-A protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 359
95 % 2 94 412
90 % 2 94 428
70 % 2 202 231
50 % 3 213 221
40 % 3 213 231
30 % 38 809 22
Entity #25 | Chains: D3,d3
40S ribosomal protein S23-A protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 369
95 % 2 90 419
90 % 2 90 436
70 % 2 205 222
50 % 2 215 217
40 % 2 215 228
30 % 2 215 237
Entity #26 | Chains: D4,d4
40S ribosomal protein S24-A protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 368
95 % 2 78 476
90 % 2 90 447
70 % 2 90 474
50 % 2 193 263
40 % 2 193 277
30 % 2 193 291
Entity #27 | Chains: D5,d5
40S ribosomal protein S25-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 50 597
95 % 2 50 796
90 % 2 50 832
70 % 2 58 772
50 % 2 58 803
40 % 2 58 839
30 % 2 60 865
Entity #28 | Chains: D6,d6
40S ribosomal protein S26-B protein, length: 97 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 47 570
95 % 1 47 762
90 % 1 51 765
70 % 1 51 788
50 % 1 86 545
40 % 1 86 585
30 % 1 86 606
Entity #29 | Chains: D7,d7
40S ribosomal protein S27-A protein, length: 81 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 378
95 % 2 87 437
90 % 2 87 461
70 % 2 176 269
50 % 2 188 264
40 % 2 188 278
30 % 2 188 292
Entity #3 | Chains: S1,s1
40S ribosomal protein S1-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 390
95 % 2 74 499
90 % 2 84 480
70 % 2 91 471
50 % 2 97 472
40 % 2 162 337
30 % 2 162 356
Entity #30 | Chains: D8,d8
40S ribosomal protein S28-A protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 644
95 % 2 90 425
90 % 2 90 446
70 % 2 193 246
50 % 2 204 228
40 % 2 205 239
30 % 2 205 251
Entity #31 | Chains: D9,d9
40S ribosomal protein S29-A protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 388
95 % 2 72 505
90 % 2 73 527
70 % 2 171 279
50 % 2 179 298
40 % 2 179 311
30 % 2 179 332
Entity #32 | Chains: E0
40S ribosomal protein S30-A protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 374
95 % 2 95 482
90 % 2 107 458
70 % 2 107 485
50 % 2 172 357
40 % 2 172 371
30 % 2 172 387
Entity #33 | Chains: E1,e1
Ubiquitin-40S ribosomal protein S31 protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 39 777
95 % 1 43 964
90 % 1 43 990
70 % 1 80 613
50 % 1 84 610
40 % 1 84 655
30 % 1 84 672
Entity #34 | Chains: SR,sR
Guanine nucleotide-binding protein subunit beta-like protein protein, length: 318 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 71 400
95 % 3 77 452
90 % 3 77 481
70 % 3 77 509
50 % 5 178 276
40 % 5 184 266
30 % 5 185 278
Entity #35 | Chains: SM,sM
Suppressor protein STM1 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1060
95 % 1 27 1380
90 % 1 27 1426
70 % 3 33 1241
50 % 3 33 1288
40 % 3 33 1323
30 % 3 33 1364
Entity #36 | Chains: 1,5
25S ribosomal RNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #37 | Chains: 3,7
5S ribosomal RNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #38 | Chains: 4,8
5.8S ribosomal RNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #39 | Chains: L2,l2
60S ribosomal protein L2-A protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 295
95 % 2 97 388
90 % 2 99 396
70 % 2 174 280
50 % 2 187 277
40 % 47 258 200
30 % 47 258 212
Entity #4 | Chains: S2,s2
40S ribosomal protein S2 protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 51 587
95 % 2 51 793
90 % 2 51 828
70 % 2 59 770
50 % 2 66 738
40 % 2 66 771
30 % 2 66 813
Entity #40 | Chains: L3,l3
60S ribosomal protein L3 protein, length: 386 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 289
95 % 2 103 354
90 % 2 105 361
70 % 2 105 400
50 % 2 198 251
40 % 2 198 261
30 % 2 200 271
Entity #41 | Chains: L4,l4
60S ribosomal protein L4-A protein, length: 361 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 266
95 % 2 107 331
90 % 2 107 350
70 % 2 109 385
50 % 2 157 344
40 % 2 198 263
30 % 2 198 279
Entity #42 | Chains: L5,l5
60S ribosomal protein L5 protein, length: 296 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 93 317
95 % 2 95 401
90 % 2 95 420
70 % 2 97 439
50 % 2 183 290
40 % 2 185 293
30 % 2 185 315
Entity #43 | Chains: L6,l6
60S ribosomal protein L6-A protein, length: 175 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 293
95 % 2 102 358
90 % 2 103 370
70 % 2 106 393
50 % 2 107 447
40 % 2 111 459
30 % 2 111 477
Entity #44 | Chains: L7,l7
60S ribosomal protein L7-A protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 270
95 % 2 103 350
90 % 2 103 371
70 % 2 105 398
50 % 2 185 281
40 % 2 185 298
30 % 2 184 323
Entity #45 | Chains: L8,l8
60S ribosomal protein L8-A protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 321
95 % 2 106 356
90 % 2 106 375
70 % 2 108 401
50 % 2 169 327
40 % 2 171 335
30 % 2 171 354
Entity #46 | Chains: L9,l9
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 271
95 % 2 102 359
90 % 2 102 377
70 % 2 104 405
50 % 2 193 272
40 % 2 195 274
30 % 47 266 205
Entity #47 | Chains: M0,m0
60S ribosomal protein L10 protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 83 345
95 % 2 83 449
90 % 2 85 471
70 % 2 85 498
50 % 2 176 309
40 % 2 176 322
30 % 2 176 339
Entity #48 | Chains: M1,m1
60S ribosomal protein L11-B protein, length: 173 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 23 1147
95 % 2 98 387
90 % 2 100 394
70 % 3 186 259
50 % 3 190 271
40 % 3 190 284
30 % 3 190 300
Entity #49 | Chains: M3,m3
60S ribosomal protein L13-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 282
95 % 2 101 373
90 % 2 101 393
70 % 2 103 414
50 % 2 103 465
40 % 2 183 305
30 % 2 183 328
Entity #5 | Chains: S3,s3
40S ribosomal protein S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 72 386
95 % 3 72 503
90 % 3 72 533
70 % 3 84 502
50 % 3 170 317
40 % 3 170 330
30 % 3 170 349
Entity #50 | Chains: M4,m4
60S ribosomal protein L14-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 269
95 % 2 103 357
90 % 2 103 376
70 % 2 105 404
50 % 2 105 459
40 % 2 105 487
30 % 2 105 505
Entity #51 | Chains: M5,m5
60S ribosomal protein L15-A protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 262
95 % 2 108 330
90 % 2 108 348
70 % 2 183 266
50 % 2 197 254
40 % 2 197 268
30 % 2 197 283
Entity #52 | Chains: M6,m6
60S ribosomal protein L16-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 307
95 % 2 95 403
90 % 2 102 380
70 % 2 104 407
50 % 2 105 458
40 % 2 106 484
30 % 2 106 502
Entity #53 | Chains: M7,m7
60S ribosomal protein L17-A protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 257
95 % 2 106 334
90 % 2 108 342
70 % 2 108 389
50 % 2 195 259
40 % 2 195 272
30 % 2 195 288
Entity #54 | Chains: M8,m8
60S ribosomal protein L18-A protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 268
95 % 2 103 355
90 % 2 105 363
70 % 2 105 403
50 % 2 186 287
40 % 2 191 289
30 % 2 191 311
Entity #55 | Chains: M9,m9
60S ribosomal protein L19-A protein, length: 188 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 297
95 % 2 97 391
90 % 2 97 408
70 % 2 100 421
50 % 2 185 285
40 % 2 186 296
30 % 2 186 320
Entity #56 | Chains: N0,n0
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 283
95 % 2 101 377
90 % 2 103 383
70 % 2 103 416
50 % 2 176 318
40 % 2 177 324
30 % 2 178 337
Entity #57 | Chains: N1,n1
60S ribosomal protein L21-A protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 294
95 % 2 97 390
90 % 2 99 400
70 % 2 99 428
50 % 2 175 316
40 % 2 181 317
30 % 2 188 309
Entity #58 | Chains: N2,n2
60S ribosomal protein L22-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 464
95 % 2 72 606
90 % 2 72 635
70 % 2 73 657
50 % 2 73 685
40 % 2 73 723
30 % 2 74 722
Entity #59 | Chains: N3,n3
60S ribosomal protein L23-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 265
95 % 2 104 348
90 % 2 106 353
70 % 2 197 240
50 % 2 198 252
40 % 2 198 262
30 % 2 198 277
Entity #6 | Chains: S4,s4
40S ribosomal protein S4-A protein, length: 260 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 371
95 % 2 77 478
90 % 2 89 456
70 % 2 182 262
50 % 2 192 253
40 % 2 192 265
30 % 2 200 263
Entity #60 | Chains: N4,n4
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 64 483
95 % 2 66 629
90 % 2 66 660
70 % 2 67 678
50 % 2 67 716
40 % 2 114 491
30 % 2 114 512
Entity #61 | Chains: N5,n5
60S ribosomal protein L25 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 434
95 % 2 77 560
90 % 2 78 581
70 % 2 78 601
50 % 2 78 635
40 % 2 80 660
30 % 2 81 671
Entity #62 | Chains: N6,n6
60S ribosomal protein L26-A protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 108 250
95 % 2 108 322
90 % 2 110 334
70 % 2 110 382
50 % 2 193 265
40 % 2 193 279
30 % 2 193 293
Entity #63 | Chains: N7,n7
60S ribosomal protein L27-A protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 304
95 % 2 97 396
90 % 2 99 404
70 % 2 99 436
50 % 2 171 325
40 % 2 184 299
30 % 2 186 316
Entity #64 | Chains: N8,n8
60S ribosomal protein L28 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 309
95 % 2 98 383
90 % 2 100 391
70 % 2 100 420
50 % 2 188 275
40 % 2 189 288
30 % 2 191 299
Entity #65 | Chains: N9,n9
60S ribosomal protein L29 protein, length: 58 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 89 330
95 % 2 89 434
90 % 2 91 444
70 % 2 91 472
50 % 2 91 508
40 % 2 91 548
30 % 2 91 576
Entity #66 | Chains: O0,o0
60S ribosomal protein L30 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 103 263
95 % 3 103 346
90 % 3 105 352
70 % 3 105 395
50 % 3 146 361
40 % 3 146 375
30 % 3 146 391
Entity #67 | Chains: O1,o1
60S ribosomal protein L31-A protein, length: 112 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 275
95 % 2 101 369
90 % 2 101 388
70 % 2 103 410
50 % 2 185 282
40 % 2 185 295
30 % 2 185 319
Entity #68 | Chains: O2,o2
60S ribosomal protein L32 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 264
95 % 2 104 347
90 % 2 104 368
70 % 2 106 396
50 % 2 189 274
40 % 2 193 280
30 % 2 194 290
Entity #69 | Chains: O3,o3
60S ribosomal protein L33-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 274
95 % 2 102 366
90 % 2 102 384
70 % 2 104 411
50 % 2 181 307
40 % 2 183 313
30 % 2 183 334
Entity #7 | Chains: S5,s5
40S ribosomal protein S5 protein, length: 224 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 357
95 % 2 79 463
90 % 2 91 433
70 % 2 91 463
50 % 2 203 229
40 % 2 203 242
30 % 2 203 256
Entity #70 | Chains: O4,o4
60S ribosomal protein L34-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 300
95 % 2 97 393
90 % 2 97 410
70 % 2 99 430
50 % 2 170 326
40 % 2 170 338
30 % 2 170 358
Entity #71 | Chains: O5,o5
60S ribosomal protein L35-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 253
95 % 2 107 328
90 % 2 107 346
70 % 2 109 384
50 % 2 188 280
40 % 2 199 259
30 % 2 201 270
Entity #72 | Chains: O6,o6
60S ribosomal protein L36-A protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 299
95 % 2 102 370
90 % 2 102 389
70 % 2 104 413
50 % 2 104 463
40 % 2 178 320
30 % 2 188 312
Entity #73 | Chains: O7,o7
60S ribosomal protein L37-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 261
95 % 2 104 345
90 % 2 104 366
70 % 2 148 309
50 % 2 193 266
40 % 2 193 282
30 % 2 193 295
Entity #74 | Chains: O8,o8
60S ribosomal protein L38 protein, length: 77 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 305
95 % 2 97 399
90 % 2 97 416
70 % 2 99 438
50 % 2 99 486
40 % 2 106 474
30 % 2 106 495
Entity #75 | Chains: O9,o9
60S ribosomal protein L39 protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 277
95 % 2 101 368
90 % 2 101 386
70 % 2 177 275
50 % 2 189 273
40 % 2 191 283
30 % 2 192 297
Entity #76 | Chains: Q0,q0
Ubiquitin-60S ribosomal protein L40 protein, length: 52 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 49 553
95 % 1 50 737
90 % 1 50 775
70 % 1 96 469
50 % 1 96 506
40 % 1 96 543
30 % 1 96 571
Entity #77 | Chains: Q1,q1
60S ribosomal protein L41-A protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 81 348
95 % 2 81 461
90 % 2 81 491
70 % 2 164 284
50 % 2 164 329
40 % 2 164 341
30 % 2 164 361
Entity #78 | Chains: Q2,q2
60S ribosomal protein L42-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 308
95 % 2 94 407
90 % 2 96 411
70 % 2 169 282
50 % 2 181 299
40 % 2 181 308
30 % 2 182 329
Entity #79 | Chains: Q3,q3
60S ribosomal protein L43-A protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 310
95 % 2 94 405
90 % 2 94 423
70 % 2 96 443
50 % 2 184 283
40 % 2 185 294
30 % 23 208 258
Entity #8 | Chains: S6,s6
40S ribosomal protein S6-A protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 377
95 % 2 77 486
90 % 2 77 510
70 % 2 89 488
50 % 2 183 288
40 % 2 188 290
30 % 2 188 310
Entity #80 | Chains: e0
40S ribosomal protein S30-A protein, length: 62 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 95 374
95 % 3 95 482
90 % 3 107 458
70 % 3 107 485
50 % 3 172 357
40 % 3 172 371
30 % 3 172 387
Entity #81 | Chains: m2
Unknown protein m2 protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #82 | Chains: p0
60S acidic ribosomal protein P0 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 54536
95 % 1 43 1537
90 % 2 47 1440
70 % 2 48 1446
50 % 2 69 1018
40 % 2 69 1038
30 % 2 69 1091
Entity #83 | Chains: p1
Unknown protein p1 protein, length: 47 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #84 | Chains: p2
Unknown protein p2 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #9 | Chains: S7,s7
40S ribosomal protein S7-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 375
95 % 2 76 483
90 % 2 88 457
70 % 2 88 484
50 % 2 189 269
40 % 2 189 286
30 % 2 192 282

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 17 AP, CP 40S ribosomal protein S15 4932
2 4U4R 17 C5, c5 40S ribosomal protein S15 4932
3 4U3U 17 C5, c5 40S ribosomal protein S15 4932
4 5TBW 64 Q, c5 40S ribosomal protein S15 4932
5 4U3M 17 C5, c5 40S ribosomal protein S15 4932
6 4U3N 17 C5, c5 40S ribosomal protein S15 4932
7 4U52 17 C5, c5 40S ribosomal protein S15 4932
8 4U4Q 17 C5, c5 40S ribosomal protein S15 4932
9 4U6F 17 C5, c5 40S ribosomal protein S15 4932
10 4U4U 17 C5, c5 40S ribosomal protein S15 4932
11 4U4Z 17 C5, c5 40S ribosomal protein S15 4932
12 4U4Y 17 C5, c5 40S ribosomal protein S15 4932
13 4U4N 17 C5, c5 40S ribosomal protein S15 4932
14 4U55 17 C5, c5 40S ribosomal protein S15 4932
15 5DAT 17 C5, c5 40S ribosomal protein S15 4932
16 5I4L 17 C5, c5 40S ribosomal protein S15 4932
17 4U51 17 C5, c5 40S ribosomal protein S15 4932
18 6HHQ 63 Q, c5 40S ribosomal protein S15 4932
19 5OBM 61 C5, c5 40S ribosomal protein S15 4932
20 4U53 17 C5, c5 40S ribosomal protein S15 4932
21 5ON6 65 Q, c5 40S ribosomal protein S15 4932
22 4U50 17 C5, c5 40S ribosomal protein S15 4932
23 5NDV 61 C5, c5 40S ribosomal protein S15 4932
24 5LYB 17 C5 40S ribosomal protein S15 4932
25 5LYB 82 c5 40S ribosomal protein S15 4932
26 4U56 17 C5, c5 40S ribosomal protein S15 4932
27 5TGA 17 C5, c5 40S ribosomal protein S15 4932
28 5MEI 64 Q, c5 40S ribosomal protein S15 4932
29 5FCJ 17 C5, c5 40S ribosomal protein S15 (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SQAVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMR NMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLK 4932
30 4U4O 17 C5, c5 40S ribosomal protein S15 4932
31 5DGV 17 C5, c5 40S ribosomal protein S15 4932
32 5DGE 17 C5, c5 40S ribosomal protein S15 4932
33 5NDW 10 C5, c5 40S ribosomal protein S15 4932
34 5NDG 17 C5, c5 40S ribosomal protein S15 4932
35 5FCI 17 C5, c5 40S ribosomal protein S15 (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SQAVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMR NMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLK 4932
36 5DC3 17 C5, c5 40S ribosomal protein S15 4932
37 5DGF 17 C5, c5 40S ribosomal protein S15 (uS19) 4932
38 5TGM 17 C5, c5 40S Ribosomal Protein S15,40S ribosomal protein S15,40S Ribosomal Protein S15 4932
39 4V7R 10 AI, CI 40S ribosomal protein S15 4932
40 5VYC 31 P1, P2, P3, P4, P5, P6 40S ribosomal protein S15 9606
41 4KZZ 16 P 40S Ribosomal Protein S15 9986
42 4KZX 16 P 40S ribosomal protein S15 9986
43 4KZY 16 P 40S Ribosomal Protein S15 9986
44 6ZOJ 17 P 40S ribosomal protein S15 9606
45 6ZOL 6 P 40S ribosomal protein S15 9606
46 6YAL 40 R 40S ribosomal protein uS19 9986
47 6YAM 40 R 40S ribosomal protein uS19 9986
48 6YAN 38 R Ribosomal protein S15 9986
49 6W2S 25 Q uS19 9986
50 6W2T 24 Q uS19 9986
51 6Y7C 15 P 40S ribosomal protein S15 4932
52 6Y57 64 SP 40S ribosomal protein S15 9606
53 6Y2L 64 SP 40S ribosomal protein S15 9606
54 6Y0G 65 SP 40S ribosomal protein S15 9606
55 6TNU 5 E 40S ribosomal protein S15 4932
56 6UZ7 63 P KLLA0F07843p 28985
57 6TB3 5 E 40S ribosomal protein S15 4932
58 6T83 4 Pb, q 40S ribosomal protein S15 4932
59 6T7T 6 SP 40S ribosomal protein S15 4932
60 6T7I 4 SP 40S ribosomal protein S15 4932
61 6T4Q 3 SP 40S ribosomal protein S15 4932
62 6SV4 34 E, Eb, Ec 40S ribosomal protein S15 4932
63 6SNT 4 P 40S ribosomal protein S15 4932
64 6SGC 17 Q1 uS19 9986
65 6S47 61 BQ 40S ribosomal protein S15 4932
66 6P5I 17 Q uS19 9986
67 6P5J 17 Q uS19 9986
68 6P5K 63 Q uS19 9986
69 6P5N 63 Q uS19 9986
70 6P4G 17 Q uS19 9986
71 6P4H 18 Q uS19 9986
72 6OM7 11 SP 40S ribosomal protein S15 9606
73 6OLZ 62 BP 40S ribosomal protein S15 9606
74 6OM0 11 SP 40S ribosomal protein S15 9606
75 6OLE 11 SP 40S ribosomal protein S15 9606
76 6OLF 11 SP 40S ribosomal protein S15 9606
77 6OLG 65 BP 40S ribosomal protein S15 9606
78 6OLI 11 SP 40S ribosomal protein S15 9606
79 6OKK 24 X 40S ribosomal protein S19 5833
80 6RBD 28 P 40S ribosomal protein S15 4932
81 6RBE 25 P 40S ribosomal protein S15 4932
82 6R7Q 85 WW uS19 9986
83 6R6G 56 WW uS19 9986
84 6R6P 76 9 uS14 9986
85 6R5Q 67 WW uS17 9986
86 6QZP 58 SP 40S ribosomal protein S15 9606
87 6Q8Y 61 E 40S ribosomal protein S15 4932
88 6I7O 34 E, Eb 40S ribosomal protein S15 4932
89 6IP5 57 2w 40S ribosomal protein S15 9606
90 6IP6 56 2w 40S ribosomal protein S15 9606
91 6IP8 56 2w 40S ribosomal protein S15 9606
92 6MTB 66 PP 40S ribosomal protein S15 9986
93 6MTC 65 PP 40S ribosomal protein S15 9986
94 6MTD 67 PP uS19 9986
95 6MTE 66 PP uS19 9986
96 6HCQ 20 Q2 uS19 9986
97 6HCJ 20 Q2 uS19 9986
98 6HCM 17 Q1 uS19 9986
99 6HCF 17 Q1 uS19 9986
100 6GZ3 10 BP ribosomal protein uS19 9986
101 6GZ4 16 BP ribosomal protein uS19 9986
102 6GZ5 10 BP ribosomal protein uS19 9986
103 6GSM 19 P KLLA0F07843p 28985
104 6GSN 7 P KLLA0F07843p 28985
105 6GQV 63 AF 40S ribosomal protein S15 4932
106 6GQ1 63 AF 40S ribosomal protein S15 4932
107 6GQB 63 AF 40S ribosomal protein S15 4932
108 6D9J 65 QQ uS19 9986
109 6D90 66 QQ uS19 9986
110 6G5H 26 P 40S ribosomal protein S15 9606
111 6G5I 17 P 40S ribosomal protein S15 9606
112 6G4S 26 P 40S ribosomal protein S15 9606
113 6G4W 22 P 40S ribosomal protein S15 9606
114 6G51 30 P 40S ribosomal protein S15 9606
115 6G53 29 P 40S ribosomal protein S15 9606
116 6G18 4 P 40S ribosomal protein S15 9606
117 6FYX 19 P KLLA0F07843p 28985
118 6FYY 19 P KLLA0F07843p 28985
119 6FEC 42 n 40S ribosomal protein S15 9606
120 6FAI 26 P 40S ribosomal protein S15 4932
121 6EML 5 E 40S ribosomal protein S15 4932
122 6EK0 58 SP 40S ribosomal protein S15 9606
123 6AZ1 23 W ribosomal protein S19 5661
124 5OPT 4 t 40S ribosomal protein S15, putative 5693
125 5XXU 17 P Ribosomal protein uS19 5811
126 5OA3 20 P 40S ribosomal protein S15 9606
127 5MC6 6 E 40S ribosomal protein S15 4932
128 5M1J 23 P2 40S ribosomal protein S15 4932
129 5LZS 66 PP uS19 9986
130 5LZT 67 PP uS19 9986
131 5LZU 66 PP uS19 9986
132 5LZV 67 PP uS19 9986
133 5LZW 67 PP uS19 9986
134 5LZX 67 PP uS19 9986
135 5LZY 65 PP uS19 9986
136 5LZZ 67 PP uS19 9986
137 5T2A 64 AI uS19 5661
138 5T2C 74 Ax 40S ribosomal protein S15 9606
139 5LKS 57 SP 40S ribosomal protein S15 9606
140 5K0Y 36 n ribosomal protein uS19 9986
141 5JUO 65 MB uS19 (yeast S15) 4932
142 5JUP 65 MB uS19 (yeast S15) 4932
143 5JUS 65 MB uS19 (yeast S15) 4932
144 5JUT 65 MB uS19 (yeast S15) 4932
145 5JUU 65 MB uS19 (yeast S15) 4932
146 5IT7 63 P KLLA0F07843p 28985
147 5IT9 16 P Ribosomal protein uS19 28985
148 5FLX 17 P 40S RIBOSOMAL PROTEIN S15 9986
149 3JAP 19 P uS19 28985
150 3JAQ 19 P uS19 28985
151 3JAM 17 P uS19 28985
152 3JAG 67 PP uS19 9986
153 3JAH 67 PP uS19 9986
154 3JAI 67 PP uS19 9986
155 5A2Q 18 P RIBOSOMAL PROTEIN US19 9606
156 4UG0 58 SP 40S RIBOSOMAL PROTEIN S15 9606
157 5AJ0 65 BP 40S ribosomal protein S15 9606
158 4UER 29 S US19 4934
159 4D61 17 P 40S RIBOSOMAL PROTEIN S15 9986
160 4D5L 17 P 40S RIBOSOMAL PROTEIN US19 9986
161 3J81 17 P uS19 28985
162 3J80 24 P uS19 28985
163 3J7P 65 SP Ribosomal protein uS19 9823
164 3J7R 66 SP Ribosomal protein uS19 9823
165 4UJC 66 CP 40S RIBOSOMAL PROTEIN US19 9986
166 4UJD 66 CP 40S RIBOSOMAL PROTEIN US19 9986
167 3J7A 24 X 40S ribosomal protein uS19 5833
168 3J77 61 15 40S ribosomal protein S15 4932
169 3J78 61 15 40S ribosomal protein S15 4932
170 3J6X 62 15 40S ribosomal protein S15 4932
171 3J6Y 62 15 40S ribosomal protein S15 4932
172 4UJE 20 BP 40S RIBOSOMAL PROTEIN S15 9986
173 4V92 18 BP US19 28985
174 4V7E 21 BP 40S ribosomal protein S19 4565
175 4V8Y 24 AP 40S RIBOSOMAL PROTEIN S15 4932
176 4V8Z 24 AP 40S RIBOSOMAL PROTEIN S15 4932
177 4V6W 13 AP 40S ribosomal protein S15, isoform A 7227
178 4V6X 13 AP 40S ribosomal protein S15 9606
179 4V8M 17 AI 40S RIBOSOMAL PROTEIN S15, PUTATIVE 185431
180 4V6I 19 AR 40S ribosomal protein rpS15 (S19p) 4932
181 4V5Z 24 As 40S Ribosomal protein S15e 9612