4U4R

Crystal structure of Lactimidomycin bound to the yeast 80S ribosome


Sequence Similarity Clusters for the Entities in PDB 4U4R

Entity #1 | Chains: 2,6
18S ribosomal RNA rna, length: 1800 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: S8,s8
40S ribosomal protein S8-A protein, length: 200 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 90 366
95 % 2 90 464
90 % 2 96 453
70 % 2 113 413
50 % 2 227 236
40 % 2 231 237
30 % 2 231 244
Entity #11 | Chains: S9,s9
40S ribosomal protein S9-A protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 317
95 % 2 101 406
90 % 2 113 358
70 % 2 223 234
50 % 2 238 223
40 % 2 249 217
30 % 2 249 223
Entity #12 | Chains: C0,c0
40S ribosomal protein S10-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 20 1549
95 % 2 71 622
90 % 2 74 602
70 % 2 90 523
50 % 2 90 554
40 % 2 90 593
30 % 2 90 619
Entity #13 | Chains: C1,c1
40S ribosomal protein S11-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 328
95 % 2 98 422
90 % 2 110 384
70 % 2 115 396
50 % 2 234 232
40 % 2 234 233
30 % 2 234 241
Entity #14 | Chains: C2,c2
40S ribosomal protein S12 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 38 1072
95 % 2 56 760
90 % 2 58 746
70 % 2 92 495
50 % 2 92 530
40 % 2 95 552
30 % 2 95 581
Entity #15 | Chains: C3,c3
40S ribosomal protein S13 protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 329
95 % 2 98 425
90 % 2 110 383
70 % 2 232 227
50 % 2 235 231
40 % 2 247 218
30 % 2 247 224
Entity #16 | Chains: C4,c4
40S ribosomal protein S14-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 504
95 % 2 112 351
90 % 2 112 371
70 % 2 236 218
50 % 2 237 226
40 % 2 237 228
30 % 2 237 235
Entity #17 | Chains: C5,c5
40S ribosomal protein S15 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 62 535
95 % 2 72 534
90 % 2 72 560
70 % 2 91 489
50 % 2 201 284
40 % 2 212 268
30 % 2 212 280
Entity #18 | Chains: C6,c6
40S ribosomal protein S16-A protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 100 314
95 % 2 112 352
90 % 2 113 365
70 % 2 113 412
50 % 2 228 234
40 % 2 239 227
30 % 2 240 230
Entity #19 | Chains: C7,c7
40S ribosomal protein S17-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 409
95 % 2 76 525
90 % 2 88 492
70 % 2 88 518
50 % 2 202 276
40 % 2 202 283
30 % 2 202 297
Entity #2 | Chains: S0,s0
40S ribosomal protein S0-A protein, length: 251 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 52 622
95 % 2 55 779
90 % 2 55 808
70 % 2 63 756
50 % 2 72 712
40 % 2 141 397
30 % 2 141 412
Entity #20 | Chains: C8,c8
40S ribosomal protein S18-A protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 89 360
95 % 2 90 453
90 % 2 102 425
70 % 2 215 241
50 % 2 224 239
40 % 2 236 230
30 % 2 237 237
Entity #21 | Chains: C9,c9
40S ribosomal protein S19-A protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 84 374
95 % 2 84 475
90 % 2 84 496
70 % 2 96 470
50 % 2 97 502
40 % 2 201 291
30 % 2 204 284
Entity #22 | Chains: D0,d0
40S ribosomal protein S20 protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 384
95 % 2 80 492
90 % 2 80 512
70 % 2 92 482
50 % 2 92 523
40 % 2 94 527
30 % 2 94 557
Entity #23 | Chains: D1,d1
40S ribosomal protein S21-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 398
95 % 2 79 503
90 % 2 91 472
70 % 2 91 496
50 % 2 200 287
40 % 2 200 298
30 % 2 200 310
Entity #24 | Chains: D2,d2
40S ribosomal protein S22-A protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 92 351
95 % 2 114 341
90 % 2 114 360
70 % 2 238 220
50 % 2 240 222
40 % 3 252 213
30 % 38 896 20
Entity #25 | Chains: D3,d3
40S ribosomal protein S23-A protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 325
95 % 2 111 357
90 % 2 111 378
70 % 2 242 211
50 % 2 255 204
40 % 2 255 210
30 % 2 255 220
Entity #26 | Chains: D4,d4
40S ribosomal protein S24-A protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 332
95 % 2 98 426
90 % 2 110 389
70 % 2 115 401
50 % 2 229 238
40 % 2 229 240
30 % 2 229 250
Entity #27 | Chains: D5,d5
40S ribosomal protein S25-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 56 583
95 % 2 56 765
90 % 2 56 798
70 % 2 64 747
50 % 2 64 781
40 % 2 64 806
30 % 2 66 836
Entity #28 | Chains: D6,d6
40S ribosomal protein S26-B protein, length: 97 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 49 598
95 % 1 49 784
90 % 1 53 773
70 % 1 53 798
50 % 1 91 550
40 % 1 91 587
30 % 1 91 613
Entity #29 | Chains: D7,d7
40S ribosomal protein S27-A protein, length: 81 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 348
95 % 2 106 388
90 % 2 106 411
70 % 2 212 244
50 % 2 224 241
40 % 2 224 243
30 % 2 224 251
Entity #3 | Chains: S1,s1
40S ribosomal protein S1-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 91 355
95 % 2 93 444
90 % 2 103 426
70 % 2 110 424
50 % 2 116 440
40 % 2 197 293
30 % 2 197 307
Entity #30 | Chains: D8,d8
40S ribosomal protein S28-A protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 92 361
95 % 2 111 354
90 % 2 111 374
70 % 2 229 229
50 % 2 243 214
40 % 2 244 219
30 % 2 244 226
Entity #31 | Chains: D9,d9
40S ribosomal protein S29-A protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 392
95 % 2 78 500
90 % 2 79 517
70 % 2 192 266
50 % 2 200 286
40 % 2 200 295
30 % 2 200 305
Entity #32 | Chains: E0
40S ribosomal protein S30-A protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 383
95 % 2 99 493
90 % 2 111 466
70 % 2 111 487
50 % 2 191 337
40 % 2 191 351
30 % 2 191 368
Entity #33 | Chains: E1,e1
Ubiquitin-40S ribosomal protein S31 protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 39 807
95 % 1 44 973
90 % 1 44 1005
70 % 1 83 605
50 % 1 87 615
40 % 1 87 660
30 % 1 87 682
Entity #34 | Chains: SR,sR
Guanine nucleotide-binding protein subunit beta-like protein protein, length: 318 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 76 402
95 % 3 83 462
90 % 3 83 480
70 % 3 83 504
50 % 5 199 268
40 % 5 205 256
30 % 5 206 266
Entity #35 | Chains: SM,sM
Suppressor protein STM1 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1105
95 % 1 27 1425
90 % 1 27 1472
70 % 3 33 1296
50 % 3 33 1328
40 % 3 33 1362
30 % 3 33 1401
Entity #36 | Chains: 1,5
25S ribosomal RNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #37 | Chains: 3,7
5S ribosomal RNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #38 | Chains: 4,8
5.8S ribosomal RNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #39 | Chains: L2,l2
60S ribosomal protein L2-A protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 300
95 % 2 106 382
90 % 2 108 397
70 % 2 195 268
50 % 2 208 267
40 % 47 282 196
30 % 47 282 206
Entity #4 | Chains: S2,s2
40S ribosomal protein S2 protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 55 595
95 % 2 55 774
90 % 2 55 803
70 % 2 63 761
50 % 2 70 735
40 % 2 70 762
30 % 2 70 805
Entity #40 | Chains: L3,l3
60S ribosomal protein L3 protein, length: 386 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 288
95 % 2 113 345
90 % 2 115 352
70 % 2 115 395
50 % 2 220 251
40 % 2 220 253
30 % 2 222 260
Entity #41 | Chains: L4,l4
60S ribosomal protein L4-A protein, length: 361 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 273
95 % 2 117 327
90 % 2 117 346
70 % 2 119 379
50 % 2 167 341
40 % 2 220 254
30 % 2 220 264
Entity #42 | Chains: L5,l5
60S ribosomal protein L5 protein, length: 296 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 312
95 % 2 103 400
90 % 2 103 420
70 % 2 105 440
50 % 2 203 283
40 % 2 205 284
30 % 2 205 298
Entity #43 | Chains: L6,l6
60S ribosomal protein L6-A protein, length: 175 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 292
95 % 2 112 350
90 % 2 113 362
70 % 2 116 390
50 % 2 117 434
40 % 2 121 449
30 % 2 121 464
Entity #44 | Chains: L7,l7
60S ribosomal protein L7-A protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 272
95 % 2 113 344
90 % 2 113 363
70 % 2 115 394
50 % 2 207 273
40 % 2 207 279
30 % 2 206 296
Entity #45 | Chains: L8,l8
60S ribosomal protein L8-A protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 109 311
95 % 2 116 347
90 % 2 116 361
70 % 2 118 393
50 % 2 191 308
40 % 2 193 317
30 % 2 193 332
Entity #46 | Chains: L9,l9
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 279
95 % 2 112 348
90 % 2 112 368
70 % 2 114 403
50 % 2 215 263
40 % 2 216 260
30 % 2 218 270
Entity #47 | Chains: M0,m0
60S ribosomal protein L10 protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 88 365
95 % 2 88 460
90 % 2 90 467
70 % 2 90 488
50 % 2 190 304
40 % 2 190 316
30 % 2 190 328
Entity #48 | Chains: M1,m1
60S ribosomal protein L11-B protein, length: 173 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 25 1143
95 % 2 106 385
90 % 2 108 401
70 % 3 206 252
50 % 3 210 266
40 % 3 210 271
30 % 3 210 283
Entity #49 | Chains: M3,m3
60S ribosomal protein L13-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 286
95 % 2 111 366
90 % 2 111 387
70 % 2 113 416
50 % 2 113 462
40 % 2 205 288
30 % 2 205 300
Entity #5 | Chains: S3,s3
40S ribosomal protein S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 78 388
95 % 3 78 494
90 % 3 78 519
70 % 3 90 491
50 % 3 191 302
40 % 3 191 314
30 % 3 191 325
Entity #50 | Chains: M4,m4
60S ribosomal protein L14-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 276
95 % 2 113 342
90 % 2 113 364
70 % 2 115 398
50 % 2 115 453
40 % 2 115 473
30 % 2 115 496
Entity #51 | Chains: M5,m5
60S ribosomal protein L15-A protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 115 264
95 % 2 118 325
90 % 2 118 345
70 % 2 205 255
50 % 2 219 253
40 % 2 219 255
30 % 2 219 269
Entity #52 | Chains: M6,m6
60S ribosomal protein L16-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 303
95 % 2 105 390
90 % 2 112 369
70 % 2 114 402
50 % 2 207 270
40 % 2 208 275
30 % 2 208 291
Entity #53 | Chains: M7,m7
60S ribosomal protein L17-A protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 116 260
95 % 2 116 330
90 % 2 118 343
70 % 2 118 383
50 % 2 217 254
40 % 2 217 258
30 % 2 217 272
Entity #54 | Chains: M8,m8
60S ribosomal protein L18-A protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 113 274
95 % 2 113 346
90 % 2 115 355
70 % 2 115 397
50 % 2 208 278
40 % 2 213 273
30 % 2 213 286
Entity #55 | Chains: M9,m9
60S ribosomal protein L19-A protein, length: 188 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 294
95 % 2 107 378
90 % 2 107 405
70 % 2 110 423
50 % 2 207 275
40 % 2 208 277
30 % 2 208 295
Entity #56 | Chains: N0,n0
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 285
95 % 2 111 365
90 % 2 113 372
70 % 2 113 415
50 % 2 198 299
40 % 2 199 304
30 % 2 200 314
Entity #57 | Chains: N1,n1
60S ribosomal protein L21-A protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 293
95 % 2 107 377
90 % 2 109 391
70 % 2 109 425
50 % 2 197 301
40 % 2 203 301
30 % 2 210 287
Entity #58 | Chains: N2,n2
60S ribosomal protein L22-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 81 432
95 % 2 81 548
90 % 2 81 576
70 % 2 82 590
50 % 2 82 635
40 % 2 82 677
30 % 2 83 677
Entity #59 | Chains: N3,n3
60S ribosomal protein L23-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 262
95 % 2 114 335
90 % 2 116 349
70 % 2 219 240
50 % 2 225 248
40 % 2 225 249
30 % 5 232 247
Entity #6 | Chains: S4,s4
40S ribosomal protein S4-A protein, length: 260 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 334
95 % 2 97 429
90 % 2 109 396
70 % 2 218 239
50 % 2 228 235
40 % 2 232 236
30 % 2 244 227
Entity #60 | Chains: N4,n4
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 68 503
95 % 2 70 639
90 % 2 70 667
70 % 2 71 685
50 % 2 71 718
40 % 2 128 468
30 % 2 128 489
Entity #61 | Chains: N5,n5
60S ribosomal protein L25 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 86 406
95 % 2 86 518
90 % 2 87 537
70 % 2 87 564
50 % 2 87 595
40 % 2 89 628
30 % 2 90 646
Entity #62 | Chains: N6,n6
60S ribosomal protein L26-A protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 118 253
95 % 2 118 321
90 % 2 120 332
70 % 2 120 373
50 % 2 215 257
40 % 2 215 263
30 % 2 215 277
Entity #63 | Chains: N7,n7
60S ribosomal protein L27-A protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 298
95 % 2 107 383
90 % 2 109 398
70 % 2 109 431
50 % 2 193 306
40 % 2 206 285
30 % 2 208 294
Entity #64 | Chains: N8,n8
60S ribosomal protein L28 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 304
95 % 2 108 368
90 % 2 110 382
70 % 2 110 420
50 % 2 210 265
40 % 2 211 270
30 % 2 216 274
Entity #65 | Chains: N9,n9
60S ribosomal protein L29 protein, length: 58 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 345
95 % 2 94 441
90 % 2 96 456
70 % 2 96 474
50 % 2 96 518
40 % 2 96 542
30 % 2 96 574
Entity #66 | Chains: O0,o0
60S ribosomal protein L30 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 113 267
95 % 3 113 337
90 % 3 115 351
70 % 3 115 386
50 % 3 156 363
40 % 3 156 379
30 % 3 156 391
Entity #67 | Chains: O1,o1
60S ribosomal protein L31-A protein, length: 112 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 280
95 % 2 111 353
90 % 2 111 375
70 % 2 113 409
50 % 2 207 271
40 % 2 207 278
30 % 2 207 293
Entity #68 | Chains: O2,o2
60S ribosomal protein L32 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 270
95 % 2 114 338
90 % 2 114 356
70 % 2 116 389
50 % 2 211 264
40 % 2 215 261
30 % 2 216 275
Entity #69 | Chains: O3,o3
60S ribosomal protein L33-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 112 283
95 % 2 112 360
90 % 2 112 381
70 % 2 114 411
50 % 2 203 291
40 % 2 205 297
30 % 2 206 306
Entity #7 | Chains: S5,s5
40S ribosomal protein S5 protein, length: 224 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 323
95 % 2 100 409
90 % 2 112 367
70 % 2 112 414
50 % 2 239 219
40 % 2 239 225
30 % 2 239 233
Entity #70 | Chains: O4,o4
60S ribosomal protein L34-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 299
95 % 2 107 384
90 % 2 107 409
70 % 2 109 433
50 % 2 192 307
40 % 2 192 318
30 % 2 192 336
Entity #71 | Chains: O5,o5
60S ribosomal protein L35-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 117 258
95 % 2 117 324
90 % 2 117 344
70 % 2 119 378
50 % 2 210 272
40 % 2 221 252
30 % 2 223 259
Entity #72 | Chains: O6,o6
60S ribosomal protein L36-A protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 108 295
95 % 2 112 358
90 % 2 112 373
70 % 2 114 407
50 % 2 114 461
40 % 2 200 302
30 % 2 210 290
Entity #73 | Chains: O7,o7
60S ribosomal protein L37-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 114 263
95 % 2 114 336
90 % 2 114 357
70 % 2 170 296
50 % 2 215 256
40 % 2 215 262
30 % 2 215 276
Entity #74 | Chains: O8,o8
60S ribosomal protein L38 protein, length: 77 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 297
95 % 2 107 381
90 % 2 107 408
70 % 2 109 428
50 % 2 109 470
40 % 2 116 463
30 % 2 116 481
Entity #75 | Chains: O9,o9
60S ribosomal protein L39 protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 111 282
95 % 2 111 356
90 % 2 111 377
70 % 2 198 265
50 % 2 216 255
40 % 2 216 259
30 % 2 217 273
Entity #76 | Chains: Q0,q0
Ubiquitin-60S ribosomal protein L40 protein, length: 52 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 50 582
95 % 1 51 757
90 % 1 51 793
70 % 1 97 484
50 % 1 97 524
40 % 1 97 560
30 % 1 97 590
Entity #77 | Chains: Q1,q1
60S ribosomal protein L41-A protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 86 371
95 % 2 86 470
90 % 2 86 491
70 % 2 183 277
50 % 2 183 314
40 % 2 183 324
30 % 2 183 343
Entity #78 | Chains: Q2,q2
60S ribosomal protein L42-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 319
95 % 2 99 417
90 % 2 101 431
70 % 2 194 269
50 % 2 201 288
40 % 2 202 296
30 % 2 202 309
Entity #79 | Chains: Q3,q3
60S ribosomal protein L43-A protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 306
95 % 2 103 399
90 % 2 103 421
70 % 2 105 441
50 % 2 205 277
40 % 2 206 282
30 % 23 229 253
Entity #8 | Chains: S6,s6
40S ribosomal protein S6-A protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 96 342
95 % 2 97 436
90 % 2 97 454
70 % 2 109 435
50 % 2 219 252
40 % 2 224 250
30 % 2 224 258
Entity #80 | Chains: e0
40S ribosomal protein S30-A protein, length: 62 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 99 383
95 % 3 99 493
90 % 3 111 466
70 % 3 111 487
50 % 3 191 337
40 % 3 191 351
30 % 3 191 368
Entity #81 | Chains: m2
Unknown protein m2 protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #82 | Chains: p0
60S acidic ribosomal protein P0 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 55421
95 % 1 44 1555
90 % 2 48 1453
70 % 2 49 1455
50 % 2 74 979
40 % 2 74 1002
30 % 2 74 1049
Entity #83 | Chains: p1
Unknown protein p1 protein, length: 47 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #84 | Chains: p2
Unknown protein p2 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #9 | Chains: S7,s7
40S ribosomal protein S7-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 96 340
95 % 2 96 437
90 % 2 108 406
70 % 2 108 436
50 % 2 226 243
40 % 2 226 245
30 % 2 229 246

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
2 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
3 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
4 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
5 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
6 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
15 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
16 5DAT 24 D2 40S ribosomal protein S22-A 4932
17 5DAT 80 d2 40S ribosomal protein S22-A 4932
18 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
19 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
20 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
21 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
22 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
23 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
24 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
25 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
26 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
27 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
28 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
29 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
30 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
31 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
33 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
34 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
35 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
36 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
37 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
38 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
39 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
40 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
41 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
42 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
43 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
44 4KZZ 23 W 40S Ribosomal Protein S15A 9986
45 4KZX 23 W 40S ribosomal protein S15A 9986
46 4KZY 23 W 40S Ribosomal Protein S15A 9986
47 6ZVH 29 W 40S ribosomal protein S15a 9606
48 6ZVI 26 E RPS22A isoform 1 4932
49 6ZQA 51 DW 40S ribosomal protein S22-A 4932
50 6ZQB 60 DW 40S ribosomal protein S22-A 4932
51 6ZQC 60 DW 40S ribosomal protein S22-A 4932
52 6ZQD 57 DW 40S ribosomal protein S22-A 4932
53 6ZQE 53 DW 40S ribosomal protein S22-A 4932
54 6ZQF 37 DW 40S ribosomal protein S22-A 4932
55 6ZQG 29 DW 40S ribosomal protein S22-A 4932
56 6ZP4 14 D 40S ribosomal protein S15a 9606
57 6ZOJ 24 W 40S ribosomal protein S15a 9606
58 6ZOK 15 W 40S ribosomal protein S15a 9606
59 6ZON 15 f 40S ribosomal protein S15a 9606
60 6ZN5 22 W 40S ribosomal protein S15a 9606
61 6ZMW 31 J 40S ribosomal protein S15a 9606
62 6ZMO 77 SW 40S ribosomal protein S15a 9606
63 6ZMT 22 W 40S ribosomal protein S15a 9606
64 6ZME 77 SW 40S ribosomal protein S15a 9606
65 6ZMI 77 SW 40S ribosomal protein S15a 9606
66 6ZLW 22 W 40S ribosomal protein S15a 9606
67 6ZM7 77 SW 40S ribosomal protein S15a 9606
68 6XIQ 69 AM RPS22A isoform 1 4932
69 6XIR 66 AM RPS22A isoform 1 4932
70 6Z6J 28 SW 40S ribosomal protein S22-A 4932
71 6Z6K 28 SW 40S ribosomal protein S22-A 4932
72 6Z6L 75 SW 40S ribosomal protein S15a 9606
73 6Z6M 75 SW 40S ribosomal protein S15a 9606
74 6Z6N 75 SW 40S ribosomal protein S15a 9606
75 6WOO 70 WW uS8 4932
76 6YBW 9 J 40S ribosomal protein S15a 9606
77 6YAL 23 Y 40S ribosomal protein uS8 9986
78 6YAM 23 Y 40S ribosomal protein uS8 9986
79 6YAN 22 Y Ribosomal protein S15a 9986
80 6W2S 15 X uS8 9986
81 6W2T 14 X uS8 9986
82 6Y7C 22 W 40S ribosomal protein S22-A 4932
83 6Y57 71 SW 40S ribosomal protein S15a 9606
84 6Y2L 71 SW 40S ribosomal protein S15a 9606
85 6Y0G 72 SW 40S ribosomal protein S15a 9606
86 6LQP 17 SX 40S ribosomal protein S22-B 4932
87 6LQQ 15 SX 40S ribosomal protein S22-B 4932
88 6LQR 15 SX 40S ribosomal protein S22-B 4932
89 6LQS 15 SX 40S ribosomal protein S22-B 4932
90 6LQT 15 SX 40S ribosomal protein S22-B 4932
91 6LQU 16 SX 40S ribosomal protein S22-B 4932
92 6TNU 26 b 40S ribosomal protein S22-A 4932
93 6TMF 10 J 30S ribosomal protein S8 2264
94 6TH6 10 Aj 30S ribosomal protein S8 311400
95 6UZ7 70 W 40S ribosomal protein S22 28985
96 6TB3 26 b 40S ribosomal protein S22-A 4932
97 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
98 6T7T 26 SW 40S ribosomal protein S22-A 4932
99 6T7I 24 SW 40S ribosomal protein S22-A 4932
100 6T4Q 23 SW 40S ribosomal protein S22-A 4932
101 6SW9 10 I 30S ribosomal protein S8 29292
102 6SWC 10 I 30S ribosomal protein S8 29292
103 6SWD 9 I 30S ribosomal protein S8 29292
104 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
105 6SNT 24 W 40S ribosomal protein S22-A 4932
106 6SKF 10 Aj 30S ribosomal protein S8 311400
107 6SKG 10 Aj 30S ribosomal protein S8 311400
108 6SGC 24 X1 Ribosomal protein S15a 9986
109 6KE6 17 SX 40S ribosomal protein S22-B 4932
110 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
111 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
112 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
113 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
114 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
115 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
116 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
117 6P5I 24 X uS8 9986
118 6P5J 24 X uS8 9986
119 6P5K 70 X uS8 9986
120 6P5N 70 X uS8 9986
121 6P4G 24 X uS8 9986
122 6P4H 25 X uS8 9986
123 6OM7 29 SW 40S ribosomal protein S15a 9606
124 6OLZ 69 BW 40S ribosomal protein S15a 9606
125 6OM0 29 SW 40S ribosomal protein S15a 9606
126 6OLE 29 SW 40S ribosomal protein S15a 9606
127 6OLF 29 SW 40S ribosomal protein S15a 9606
128 6OLG 72 BW 40S ribosomal protein S15a 9606
129 6OLI 29 SW 40S ribosomal protein S15a 9606
130 6OKK 11 K 40S ribosomal protein S15A 5833
131 6RBD 15 W 40S ribosomal protein S22-A 4932
132 6RBE 15 W 40S ribosomal protein S22-A 4932
133 6R7Q 82 TT Ribosomal protein S15a 9986
134 6R6G 50 TT Ribosomal protein S15a 9986
135 6R6P 66 TT Ribosomal protein S15a 9986
136 6R5Q 74 TT Ribosomal protein S15a 9986
137 6QZP 76 SW 40S ribosomal protein S15a 9606
138 6Q8Y 27 b 40S ribosomal protein S22-A 4932
139 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
140 6IP5 75 3M 40S ribosomal protein S15a 9606
141 6IP6 74 3M 40S ribosomal protein S15a 9606
142 6IP8 74 3M 40S ribosomal protein S15a 9606
143 6MTB 73 WW 40S ribosomal protein S15a 9986
144 6MTC 72 WW 40S ribosomal protein S15a 9986
145 6MTD 74 WW uS8 9986
146 6MTE 73 WW uS8 9986
147 6HCQ 27 X2 Ribosomal protein S15a 9986
148 6HCJ 27 X2 Ribosomal protein S15a 9986
149 6HCM 24 X1 Ribosomal protein S15a 9986
150 6HCF 24 X1 Ribosomal protein S15a 9986
151 6GZ3 33 BW Ribosomal protein S15a 9986
152 6GZ4 36 BW ribosomal protein uS8 9986
153 6GZ5 33 BW ribosomal protein uS8 9986
154 6GSM 26 W 40S ribosomal protein S22 28985
155 6GSN 40 W 40S ribosomal protein S22 28985
156 6GQV 70 AM 40S ribosomal protein S22-A 4932
157 6GQ1 70 AM 40S ribosomal protein S22-A 4932
158 6GQB 70 AM 40S ribosomal protein S22-A 4932
159 6D9J 72 XX uS8 9986
160 6D90 73 XX uS8 9986
161 6G5H 14 W 40S ribosomal protein S15a 9606
162 6G5I 24 W 40S ribosomal protein S15a 9606
163 6G4S 19 W 40S ribosomal protein S15a 9606
164 6G4W 16 W 40S ribosomal protein S15a 9606
165 6G51 15 W 40S ribosomal protein S15a 9606
166 6G53 15 W 40S ribosomal protein S15a 9606
167 6G18 25 W 40S ribosomal protein S15a 9606
168 6FYX 26 W 40S ribosomal protein S22 28985
169 6FYY 26 W 40S ribosomal protein S22 28985
170 6FEC 29 a 40S ribosomal protein S15a 9606
171 6FAI 33 W 40S ribosomal protein S22-A 4932
172 6EML 24 b 40S ribosomal protein S22-A 4932
173 6EK0 76 SW 40S ribosomal protein S15a 9606
174 6AZ1 10 J ribosomal protein S8 5661
175 5OQL 45 w 40S ribosomal protein S22-like protein 209285
176 5OPT 22 e 40S ribosomal protein S15a, putative 5693
177 5WLC 13 LE rpS22_uS8 4932
178 5XYI 24 W Ribosomal protein S15a 5722
179 5XXU 24 W Ribosomal protein uS8 5811
180 5OA3 27 W 40S ribosomal protein S15a 9606
181 5WYJ 47 SX 40S ribosomal protein S22-A 4932
182 5WYK 43 SX 40S ribosomal protein S22-A 4932
183 5TZS 14 E rpS22_uS8 4932
184 5MC6 29 b 40S ribosomal protein S22-A 4932
185 5M1J 30 W2 40S ribosomal protein S22-A 4932
186 5LZS 73 WW uS8 9986
187 5LZT 74 WW uS8 9986
188 5LZU 73 WW uS8 9986
189 5LZV 74 WW uS8 9986
190 5LZW 74 WW uS8 9986
191 5LZX 74 WW uS8 9986
192 5LZY 72 WW uS8 9986
193 5LZZ 74 WW uS8 9986
194 5T2A 65 AJ uS8 5661
195 5T2C 57 AP 40S ribosomal protein S15a 9606
196 5LL6 14 b 40S ribosomal protein S22-A 4932
197 5LKS 75 SW 40S ribosomal protein S15a 9606
198 5K0Y 23 a ribosomal protein uS8 9986
199 5JUO 72 TB uS8 (yeast S22) 4932
200 5JUP 72 TB uS8 (yeast S22) 4932
201 5JUS 72 TB uS8 (yeast S22) 4932
202 5JUT 72 TB uS8 (yeast S22) 4932
203 5JUU 72 TB uS8 (yeast S22) 4932
204 5JPQ 32 z uS8 209285
205 5JB3 15 I 30S ribosomal protein S8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
206 5JBH 26 I 30S ribosomal protein uS8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
207 5IT7 70 W 40S ribosomal protein S22 28985
208 5IT9 23 W Ribosomal protein uS8 28985
209 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
210 3JBN 7 K 40S ribosomal protein uS8 5833
211 3JBO 29 K 40S ribosomal protein uS8 5833
212 3JBP 7 K 40S ribosomal protein uS8 5833
213 3JAP 26 W uS8 28985
214 3JAQ 26 W uS8 28985
215 3JAM 24 W uS8 28985
216 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
217 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
218 3JAG 74 WW uS8 9986
219 3JAH 74 WW uS8 9986
220 3JAI 74 WW uS8 9986
221 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
222 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
223 5AJ0 72 BW 40S ribosomal protein S15a 9606
224 4UER 18 H US8 4934
225 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
226 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
227 4V3P 27 SH Ribosomal protein S15 4565
228 3J81 24 W uS8 28985
229 3J80 14 W uS8 28985
230 3J7P 72 SW Ribosomal protein uS8 9823
231 3J7R 73 SW Ribosomal protein uS8 9823
232 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
233 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
234 3J7A 11 K 40S ribosomal protein uS8 5833
235 3J77 68 22 40S ribosomal protein S22 4932
236 3J78 68 22 40S ribosomal protein S22 4932
237 3J6X 69 22 40S ribosomal protein S22 4932
238 3J6Y 69 22 40S ribosomal protein S22 4932
239 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
240 4V92 25 BW US8 28985
241 4V7E 24 BW 40S ribosomal protein S8 4565
242 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
243 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
244 4V4N 21 BI 30S ribosomal protein S8P SEE REMARK 999 2190
245 4V6W 32 AW 40S ribosomal protein S15Aa 7227
246 4V6X 32 AW 40S ribosomal protein S15a 9606
247 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
248 4V6U 3 AI 30S ribosomal protein S8P 2261
249 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
250 4V7H 7 AH 40S ribosomal protein S22(A) 5541
251 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
252 4V4B 8 AH 40S ribosomal protein S22 4932