4U4R

Crystal structure of Lactimidomycin bound to the yeast 80S ribosome


Sequence Similarity Clusters for the Entities in PDB 4U4R

Entity #1 | Chains: 2,6
18S ribosomal RNA rna, length: 1800 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #10 | Chains: S8,s8
40S ribosomal protein S8-A protein, length: 200 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 413
95 % 2 70 529
90 % 2 76 512
70 % 2 93 461
50 % 2 191 256
40 % 2 195 257
30 % 2 195 273
Entity #11 | Chains: S9,s9
40S ribosomal protein S9-A protein, length: 196 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 351
95 % 2 80 459
90 % 2 92 432
70 % 2 186 251
50 % 2 201 235
40 % 2 209 235
30 % 2 209 247
Entity #12 | Chains: C0,c0
40S ribosomal protein S10-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 19 1561
95 % 2 65 620
90 % 2 68 627
70 % 2 84 536
50 % 2 84 567
40 % 2 84 607
30 % 2 84 624
Entity #13 | Chains: C1,c1
40S ribosomal protein S11-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 364
95 % 2 78 473
90 % 2 90 437
70 % 2 95 449
50 % 2 198 240
40 % 2 198 249
30 % 2 198 264
Entity #14 | Chains: C2,c2
40S ribosomal protein S12 protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 33 1144
95 % 2 51 775
90 % 2 53 776
70 % 2 85 505
50 % 2 85 533
40 % 2 88 560
30 % 2 88 586
Entity #15 | Chains: C3,c3
40S ribosomal protein S13 protein, length: 150 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 356
95 % 2 78 465
90 % 2 90 442
70 % 2 195 241
50 % 2 198 242
40 % 2 206 238
30 % 2 207 249
Entity #16 | Chains: C4,c4
40S ribosomal protein S14-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 350
95 % 2 92 414
90 % 2 92 429
70 % 2 199 228
50 % 2 200 237
40 % 2 200 248
30 % 2 200 262
Entity #17 | Chains: C5,c5
40S ribosomal protein S15 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 58 536
95 % 2 68 546
90 % 2 68 574
70 % 2 86 499
50 % 2 181 294
40 % 2 189 287
30 % 2 189 304
Entity #18 | Chains: C6,c6
40S ribosomal protein S16-A protein, length: 142 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 353
95 % 2 91 416
90 % 2 92 430
70 % 2 92 462
50 % 2 192 250
40 % 2 200 247
30 % 2 201 261
Entity #19 | Chains: C7,c7
40S ribosomal protein S17-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 70 420
95 % 2 70 531
90 % 2 82 492
70 % 2 82 519
50 % 2 178 295
40 % 2 178 306
30 % 2 178 330
Entity #2 | Chains: S0,s0
40S ribosomal protein S0-A protein, length: 251 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 610
95 % 2 51 787
90 % 2 51 824
70 % 2 59 771
50 % 2 68 712
40 % 2 133 405
30 % 2 133 418
Entity #20 | Chains: C8,c8
40S ribosomal protein S18-A protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 376
95 % 2 76 477
90 % 2 88 453
70 % 2 185 252
50 % 2 194 246
40 % 2 204 241
30 % 2 204 252
Entity #21 | Chains: C9,c9
40S ribosomal protein S19-A protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 74 382
95 % 2 74 495
90 % 2 74 521
70 % 2 86 496
50 % 2 176 304
40 % 2 176 316
30 % 2 180 314
Entity #22 | Chains: D0,d0
40S ribosomal protein S20 protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 384
95 % 2 74 490
90 % 2 74 516
70 % 2 86 491
50 % 2 86 525
40 % 2 88 539
30 % 2 88 566
Entity #23 | Chains: D1,d1
40S ribosomal protein S21-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 389
95 % 2 73 501
90 % 2 85 473
70 % 2 85 501
50 % 2 172 315
40 % 2 172 328
30 % 2 172 346
Entity #24 | Chains: D2,d2
40S ribosomal protein S22-A protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 79 359
95 % 2 94 412
90 % 2 94 428
70 % 2 202 231
50 % 3 213 221
40 % 3 213 231
30 % 38 809 22
Entity #25 | Chains: D3,d3
40S ribosomal protein S23-A protein, length: 144 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 369
95 % 2 90 419
90 % 2 90 436
70 % 2 205 222
50 % 2 215 217
40 % 2 215 228
30 % 2 215 237
Entity #26 | Chains: D4,d4
40S ribosomal protein S24-A protein, length: 134 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 368
95 % 2 78 476
90 % 2 90 447
70 % 2 90 474
50 % 2 193 263
40 % 2 193 277
30 % 2 193 291
Entity #27 | Chains: D5,d5
40S ribosomal protein S25-A protein, length: 107 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 50 597
95 % 2 50 796
90 % 2 50 832
70 % 2 58 772
50 % 2 58 803
40 % 2 58 839
30 % 2 60 865
Entity #28 | Chains: D6,d6
40S ribosomal protein S26-B protein, length: 97 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 47 570
95 % 1 47 762
90 % 1 51 765
70 % 1 51 788
50 % 1 86 545
40 % 1 86 585
30 % 1 86 606
Entity #29 | Chains: D7,d7
40S ribosomal protein S27-A protein, length: 81 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 75 378
95 % 2 87 437
90 % 2 87 461
70 % 2 176 269
50 % 2 188 264
40 % 2 188 278
30 % 2 188 292
Entity #3 | Chains: S1,s1
40S ribosomal protein S1-A protein, length: 254 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 73 390
95 % 2 74 499
90 % 2 84 480
70 % 2 91 471
50 % 2 97 472
40 % 2 162 337
30 % 2 162 356
Entity #30 | Chains: D8,d8
40S ribosomal protein S28-A protein, length: 66 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 48 644
95 % 2 90 425
90 % 2 90 446
70 % 2 193 246
50 % 2 204 228
40 % 2 205 239
30 % 2 205 251
Entity #31 | Chains: D9,d9
40S ribosomal protein S29-A protein, length: 55 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 388
95 % 2 72 505
90 % 2 73 527
70 % 2 171 279
50 % 2 179 298
40 % 2 179 311
30 % 2 179 332
Entity #32 | Chains: E0
40S ribosomal protein S30-A protein, length: 60 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 374
95 % 2 95 482
90 % 2 107 458
70 % 2 107 485
50 % 2 172 357
40 % 2 172 371
30 % 2 172 387
Entity #33 | Chains: E1,e1
Ubiquitin-40S ribosomal protein S31 protein, length: 76 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 39 777
95 % 1 43 964
90 % 1 43 990
70 % 1 80 613
50 % 1 84 610
40 % 1 84 655
30 % 1 84 672
Entity #34 | Chains: SR,sR
Guanine nucleotide-binding protein subunit beta-like protein protein, length: 318 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 71 400
95 % 3 77 452
90 % 3 77 481
70 % 3 77 509
50 % 5 178 276
40 % 5 184 266
30 % 5 185 278
Entity #35 | Chains: SM,sM
Suppressor protein STM1 protein, length: 273 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1060
95 % 1 27 1380
90 % 1 27 1426
70 % 3 33 1241
50 % 3 33 1288
40 % 3 33 1323
30 % 3 33 1364
Entity #36 | Chains: 1,5
25S ribosomal RNA rna, length: 3396 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #37 | Chains: 3,7
5S ribosomal RNA rna, length: 121 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #38 | Chains: 4,8
5.8S ribosomal RNA rna, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #39 | Chains: L2,l2
60S ribosomal protein L2-A protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 295
95 % 2 97 388
90 % 2 99 396
70 % 2 174 280
50 % 2 187 277
40 % 47 258 200
30 % 47 258 212
Entity #4 | Chains: S2,s2
40S ribosomal protein S2 protein, length: 253 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 51 587
95 % 2 51 793
90 % 2 51 828
70 % 2 59 770
50 % 2 66 738
40 % 2 66 771
30 % 2 66 813
Entity #40 | Chains: L3,l3
60S ribosomal protein L3 protein, length: 386 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 289
95 % 2 103 354
90 % 2 105 361
70 % 2 105 400
50 % 2 198 251
40 % 2 198 261
30 % 2 200 271
Entity #41 | Chains: L4,l4
60S ribosomal protein L4-A protein, length: 361 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 266
95 % 2 107 331
90 % 2 107 350
70 % 2 109 385
50 % 2 157 344
40 % 2 198 263
30 % 2 198 279
Entity #42 | Chains: L5,l5
60S ribosomal protein L5 protein, length: 296 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 93 317
95 % 2 95 401
90 % 2 95 420
70 % 2 97 439
50 % 2 183 290
40 % 2 185 293
30 % 2 185 315
Entity #43 | Chains: L6,l6
60S ribosomal protein L6-A protein, length: 175 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 293
95 % 2 102 358
90 % 2 103 370
70 % 2 106 393
50 % 2 107 447
40 % 2 111 459
30 % 2 111 477
Entity #44 | Chains: L7,l7
60S ribosomal protein L7-A protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 270
95 % 2 103 350
90 % 2 103 371
70 % 2 105 398
50 % 2 185 281
40 % 2 185 298
30 % 2 184 323
Entity #45 | Chains: L8,l8
60S ribosomal protein L8-A protein, length: 255 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 99 321
95 % 2 106 356
90 % 2 106 375
70 % 2 108 401
50 % 2 169 327
40 % 2 171 335
30 % 2 171 354
Entity #46 | Chains: L9,l9
60S ribosomal protein L9-A protein, length: 191 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 271
95 % 2 102 359
90 % 2 102 377
70 % 2 104 405
50 % 2 193 272
40 % 2 195 274
30 % 47 266 205
Entity #47 | Chains: M0,m0
60S ribosomal protein L10 protein, length: 220 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 83 345
95 % 2 83 449
90 % 2 85 471
70 % 2 85 498
50 % 2 176 309
40 % 2 176 322
30 % 2 176 339
Entity #48 | Chains: M1,m1
60S ribosomal protein L11-B protein, length: 173 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 23 1147
95 % 2 98 387
90 % 2 100 394
70 % 3 186 259
50 % 3 190 271
40 % 3 190 284
30 % 3 190 300
Entity #49 | Chains: M3,m3
60S ribosomal protein L13-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 282
95 % 2 101 373
90 % 2 101 393
70 % 2 103 414
50 % 2 103 465
40 % 2 183 305
30 % 2 183 328
Entity #5 | Chains: S3,s3
40S ribosomal protein S3 protein, length: 239 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 72 386
95 % 3 72 503
90 % 3 72 533
70 % 3 84 502
50 % 3 170 317
40 % 3 170 330
30 % 3 170 349
Entity #50 | Chains: M4,m4
60S ribosomal protein L14-A protein, length: 137 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 269
95 % 2 103 357
90 % 2 103 376
70 % 2 105 404
50 % 2 105 459
40 % 2 105 487
30 % 2 105 505
Entity #51 | Chains: M5,m5
60S ribosomal protein L15-A protein, length: 203 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 105 262
95 % 2 108 330
90 % 2 108 348
70 % 2 183 266
50 % 2 197 254
40 % 2 197 268
30 % 2 197 283
Entity #52 | Chains: M6,m6
60S ribosomal protein L16-A protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 307
95 % 2 95 403
90 % 2 102 380
70 % 2 104 407
50 % 2 105 458
40 % 2 106 484
30 % 2 106 502
Entity #53 | Chains: M7,m7
60S ribosomal protein L17-A protein, length: 183 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 106 257
95 % 2 106 334
90 % 2 108 342
70 % 2 108 389
50 % 2 195 259
40 % 2 195 272
30 % 2 195 288
Entity #54 | Chains: M8,m8
60S ribosomal protein L18-A protein, length: 185 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 103 268
95 % 2 103 355
90 % 2 105 363
70 % 2 105 403
50 % 2 186 287
40 % 2 191 289
30 % 2 191 311
Entity #55 | Chains: M9,m9
60S ribosomal protein L19-A protein, length: 188 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 297
95 % 2 97 391
90 % 2 97 408
70 % 2 100 421
50 % 2 185 285
40 % 2 186 296
30 % 2 186 320
Entity #56 | Chains: N0,n0
60S ribosomal protein L20-A protein, length: 172 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 283
95 % 2 101 377
90 % 2 103 383
70 % 2 103 416
50 % 2 176 318
40 % 2 177 324
30 % 2 178 337
Entity #57 | Chains: N1,n1
60S ribosomal protein L21-A protein, length: 159 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 294
95 % 2 97 390
90 % 2 99 400
70 % 2 99 428
50 % 2 175 316
40 % 2 181 317
30 % 2 188 309
Entity #58 | Chains: N2,n2
60S ribosomal protein L22-A protein, length: 120 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 72 464
95 % 2 72 606
90 % 2 72 635
70 % 2 73 657
50 % 2 73 685
40 % 2 73 723
30 % 2 74 722
Entity #59 | Chains: N3,n3
60S ribosomal protein L23-A protein, length: 136 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 265
95 % 2 104 348
90 % 2 106 353
70 % 2 197 240
50 % 2 198 252
40 % 2 198 262
30 % 2 198 277
Entity #6 | Chains: S4,s4
40S ribosomal protein S4-A protein, length: 260 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 371
95 % 2 77 478
90 % 2 89 456
70 % 2 182 262
50 % 2 192 253
40 % 2 192 265
30 % 2 200 263
Entity #60 | Chains: N4,n4
60S ribosomal protein L24-A protein, length: 155 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 64 483
95 % 2 66 629
90 % 2 66 660
70 % 2 67 678
50 % 2 67 716
40 % 2 114 491
30 % 2 114 512
Entity #61 | Chains: N5,n5
60S ribosomal protein L25 protein, length: 141 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 77 434
95 % 2 77 560
90 % 2 78 581
70 % 2 78 601
50 % 2 78 635
40 % 2 80 660
30 % 2 81 671
Entity #62 | Chains: N6,n6
60S ribosomal protein L26-A protein, length: 126 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 108 250
95 % 2 108 322
90 % 2 110 334
70 % 2 110 382
50 % 2 193 265
40 % 2 193 279
30 % 2 193 293
Entity #63 | Chains: N7,n7
60S ribosomal protein L27-A protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 304
95 % 2 97 396
90 % 2 99 404
70 % 2 99 436
50 % 2 171 325
40 % 2 184 299
30 % 2 186 316
Entity #64 | Chains: N8,n8
60S ribosomal protein L28 protein, length: 148 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 95 309
95 % 2 98 383
90 % 2 100 391
70 % 2 100 420
50 % 2 188 275
40 % 2 189 288
30 % 2 191 299
Entity #65 | Chains: N9,n9
60S ribosomal protein L29 protein, length: 58 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 89 330
95 % 2 89 434
90 % 2 91 444
70 % 2 91 472
50 % 2 91 508
40 % 2 91 548
30 % 2 91 576
Entity #66 | Chains: O0,o0
60S ribosomal protein L30 protein, length: 104 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 103 263
95 % 3 103 346
90 % 3 105 352
70 % 3 105 395
50 % 3 146 361
40 % 3 146 375
30 % 3 146 391
Entity #67 | Chains: O1,o1
60S ribosomal protein L31-A protein, length: 112 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 275
95 % 2 101 369
90 % 2 101 388
70 % 2 103 410
50 % 2 185 282
40 % 2 185 295
30 % 2 185 319
Entity #68 | Chains: O2,o2
60S ribosomal protein L32 protein, length: 129 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 264
95 % 2 104 347
90 % 2 104 368
70 % 2 106 396
50 % 2 189 274
40 % 2 193 280
30 % 2 194 290
Entity #69 | Chains: O3,o3
60S ribosomal protein L33-A protein, length: 106 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 102 274
95 % 2 102 366
90 % 2 102 384
70 % 2 104 411
50 % 2 181 307
40 % 2 183 313
30 % 2 183 334
Entity #7 | Chains: S5,s5
40S ribosomal protein S5 protein, length: 224 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 78 357
95 % 2 79 463
90 % 2 91 433
70 % 2 91 463
50 % 2 203 229
40 % 2 203 242
30 % 2 203 256
Entity #70 | Chains: O4,o4
60S ribosomal protein L34-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 300
95 % 2 97 393
90 % 2 97 410
70 % 2 99 430
50 % 2 170 326
40 % 2 170 338
30 % 2 170 358
Entity #71 | Chains: O5,o5
60S ribosomal protein L35-A protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 107 253
95 % 2 107 328
90 % 2 107 346
70 % 2 109 384
50 % 2 188 280
40 % 2 199 259
30 % 2 201 270
Entity #72 | Chains: O6,o6
60S ribosomal protein L36-A protein, length: 99 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 98 299
95 % 2 102 370
90 % 2 102 389
70 % 2 104 413
50 % 2 104 463
40 % 2 178 320
30 % 2 188 312
Entity #73 | Chains: O7,o7
60S ribosomal protein L37-A protein, length: 87 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 104 261
95 % 2 104 345
90 % 2 104 366
70 % 2 148 309
50 % 2 193 266
40 % 2 193 282
30 % 2 193 295
Entity #74 | Chains: O8,o8
60S ribosomal protein L38 protein, length: 77 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 97 305
95 % 2 97 399
90 % 2 97 416
70 % 2 99 438
50 % 2 99 486
40 % 2 106 474
30 % 2 106 495
Entity #75 | Chains: O9,o9
60S ribosomal protein L39 protein, length: 50 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 101 277
95 % 2 101 368
90 % 2 101 386
70 % 2 177 275
50 % 2 189 273
40 % 2 191 283
30 % 2 192 297
Entity #76 | Chains: Q0,q0
Ubiquitin-60S ribosomal protein L40 protein, length: 52 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 49 553
95 % 1 50 737
90 % 1 50 775
70 % 1 96 469
50 % 1 96 506
40 % 1 96 543
30 % 1 96 571
Entity #77 | Chains: Q1,q1
60S ribosomal protein L41-A protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 81 348
95 % 2 81 461
90 % 2 81 491
70 % 2 164 284
50 % 2 164 329
40 % 2 164 341
30 % 2 164 361
Entity #78 | Chains: Q2,q2
60S ribosomal protein L42-A protein, length: 105 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 308
95 % 2 94 407
90 % 2 96 411
70 % 2 169 282
50 % 2 181 299
40 % 2 181 308
30 % 2 182 329
Entity #79 | Chains: Q3,q3
60S ribosomal protein L43-A protein, length: 91 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 94 310
95 % 2 94 405
90 % 2 94 423
70 % 2 96 443
50 % 2 184 283
40 % 2 185 294
30 % 23 208 258
Entity #8 | Chains: S6,s6
40S ribosomal protein S6-A protein, length: 236 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 377
95 % 2 77 486
90 % 2 77 510
70 % 2 89 488
50 % 2 183 288
40 % 2 188 290
30 % 2 188 310
Entity #80 | Chains: e0
40S ribosomal protein S30-A protein, length: 62 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 95 374
95 % 3 95 482
90 % 3 107 458
70 % 3 107 485
50 % 3 172 357
40 % 3 172 371
30 % 3 172 387
Entity #81 | Chains: m2
Unknown protein m2 protein, length: 160 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #82 | Chains: p0
60S acidic ribosomal protein P0 protein, length: 311 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 54536
95 % 1 43 1537
90 % 2 47 1440
70 % 2 48 1446
50 % 2 69 1018
40 % 2 69 1038
30 % 2 69 1091
Entity #83 | Chains: p1
Unknown protein p1 protein, length: 47 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #84 | Chains: p2
Unknown protein p2 protein, length: 46 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #9 | Chains: S7,s7
40S ribosomal protein S7-A protein, length: 189 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 76 375
95 % 2 76 483
90 % 2 88 457
70 % 2 88 484
50 % 2 189 269
40 % 2 189 286
30 % 2 192 282

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 64 Ba, Da 60S ribosomal protein L28 4932
2 4U4R 64 N8, n8 60S ribosomal protein L28 4932
3 4U3U 64 N8, n8 60S ribosomal protein L28 4932
4 5TBW 29 AB, DC 60S ribosomal protein L28 4932
5 4U3M 64 N8, n8 60S ribosomal protein L28 4932
6 4U3N 64 N8, n8 60S ribosomal protein L28 4932
7 4U52 64 N8, n8 60S ribosomal protein L28 4932
8 4U4Q 64 N8, n8 60S ribosomal protein L28 4932
9 4U6F 64 N8, n8 60S ribosomal protein L28 4932
10 4U4U 64 N8, n8 60S ribosomal protein L28 4932
11 4U4Z 64 N8, n8 60S ribosomal protein L28 4932
12 4U4Y 64 N8, n8 60S ribosomal protein L28 4932
13 4U4N 64 N8, n8 60S ribosomal protein L28 4932
14 4U55 64 N8, n8 60S ribosomal protein L28 4932
15 5DAT 64 N8, n8 60S ribosomal protein L28 4932
16 5I4L 64 N8, n8 60S ribosomal protein L28 4932
17 4U51 64 N8, n8 60S ribosomal protein L28 4932
18 6HHQ 29 AB, DC 60S ribosomal protein L28 4932
19 5OBM 29 N8, n8 60S ribosomal protein L28 4932
20 4U53 64 N8, n8 60S ribosomal protein L28 4932
21 5ON6 30 AB, DC 60S ribosomal protein L28 4932
22 4U50 64 N8, n8 60S ribosomal protein L28 4932
23 5NDV 29 N8, n8 60S ribosomal protein L28 4932
24 5LYB 64 N8, n8 60S ribosomal protein L28 4932
25 4U56 64 N8, n8 60S ribosomal protein L28 4932
26 5TGA 64 N8, n8 60S ribosomal protein L28 4932
27 5MEI 30 AB, DC 60S ribosomal protein L28 4932
28 5FCJ 64 N8, n8 60S ribosomal protein L28 4932
29 4U4O 64 N8, n8 60S ribosomal protein L28 4932
30 5DGV 64 N8, n8 60S ribosomal protein L28 4932
31 5DGE 64 N8, n8 60S ribosomal protein L28 4932
32 5NDW 52 N8, n8 60S ribosomal protein L28 4932
33 4V8P 32 BK, CK, EK, GK 60S RIBOSOMAL PROTEIN L27A 5911
34 5NDG 64 N8, n8 60S ribosomal protein L28 4932
35 5FCI 64 N8, n8 60S ribosomal protein L28 4932
36 5DC3 64 N8, n8 60S ribosomal protein L28 4932
37 5DGF 64 N8, n8 60S ribosomal protein L28 4932
38 5TGM 64 N8, n8 60S ribosomal protein L28 4932
39 4V7R 54 BY, DY 60S ribosomal protein L28 4932
40 6Y6X 29 La 60S ribosomal protein L27a 9606
41 6Y57 32 La 60S ribosomal protein L27a 9606
42 6Y2L 32 La 60S ribosomal protein L27a 9606
43 6Y0G 32 La 60S ribosomal protein L27a 9606
44 6TNU 66 AR 60S ribosomal protein L28 4932
45 6UZ7 29 Ba RPL28 28985
46 6TB3 66 AR 60S ribosomal protein L28 4932
47 6T83 62 L, ay 60S ribosomal protein L28 4932
48 6T7T 62 La 60S ribosomal protein L28 4932
49 6T7I 62 La 60S ribosomal protein L28 4932
50 6T59 26 a3 uL15 9986
51 6T4Q 61 La 60S ribosomal protein L28 4932
52 6SV4 63 AR, XR, zR 60S ribosomal protein L28 4932
53 6SNT 62 ap 60S ribosomal protein L28 4932
54 6SGC 61 a2 Ribosomal_L18e/L15P domain-containing protein 9986
55 6S47 29 Ac 60S ribosomal protein L28 4932
56 6RZZ 13 N 60S ribosomal protein L28 4932
57 6S05 13 N 60S ribosomal protein L28 4932
58 6P5I 64 Aa uL15 9986
59 6P5J 64 Aa uL15 9986
60 6P5K 29 Aa uL15 9986
61 6P5N 29 Aa uL15 9986
62 6RM3 5 LAA uL15 6039
63 6RI5 13 N 60S ribosomal protein L28 MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRY FHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPN VPVIVKARFVSKLAEEKIRAAGGVVELIA 4932
64 6OM7 62 b 60S ribosomal protein L27a 9606
65 6OLZ 31 Aa 60S ribosomal protein L27a 9606
66 6OM0 62 b 60S ribosomal protein L27a 9606
67 6OLE 62 b 60S ribosomal protein L27a 9606
68 6OLF 61 b 60S ribosomal protein L27a 9606
69 6OLG 32 Aa 60S ribosomal protein L27a 9606
70 6OLI 62 b 60S ribosomal protein L27a 9606
71 6R84 37 c 60S ribosomal protein L28 4932
72 6R86 35 c 60S ribosomal protein L28 4932
73 6R87 36 c 60S ribosomal protein L28 4932
74 6R7Q 56 a uL15 9986
75 6R6G 60 a uL15 9986
76 6R6P 29 a uL15 9986
77 6R5Q 32 a uL15 9986
78 6QZP 29 La 60S ribosomal protein L27a 9606
79 6QTZ 13 N 60S ribosomal protein L28 4932
80 6QT0 14 N 60S ribosomal protein L28 4932
81 6QIK 13 N 60S ribosomal protein L28 4932
82 6Q8Y 19 AR 60S ribosomal protein L28 4932
83 6N8J 4 a 60S ribosomal protein L28 4932
84 6N8K 4 a 60S ribosomal protein L28 4932
85 6N8L 4 a 60S ribosomal protein L28 4932
86 6N8M 32 n 60S ribosomal protein L28 4932
87 6N8N 35 n 60S ribosomal protein L28 4932
88 6N8O 37 n 60S ribosomal protein L28 4932
89 6I7O 63 AR, XR 60S ribosomal protein L28 4932
90 6IP5 29 2U 60S ribosomal protein L27a 9606
91 6IP6 29 2U 60S ribosomal protein L27a 9606
92 6IP8 29 2U 60S ribosomal protein L27a 9606
93 6MTB 32 a 60S ribosomal protein L27a 9986
94 6MTC 30 a 60S ribosomal protein L27a 9986
95 6MTD 29 a uL15 9986
96 6MTE 29 a uL15 9986
97 6HD7 32 c 60S ribosomal protein L28 4932
98 6HCQ 62 a3 uL15 9986
99 6HCJ 62 a3 uL15 9986
100 6HCM 61 a3 uL15 9986
101 6HCF 61 a3 uL15 9986
102 6GZ3 66 Aa ribosomal protein uL15 9986
103 6GZ4 66 Aa ribosomal protein uL15 9986
104 6GZ5 66 Aa ribosomal protein uL15 9986
105 6GQV 31 a 60S ribosomal protein L28 4932
106 6GQ1 31 a 60S ribosomal protein L28 4932
107 6GQB 31 a 60S ribosomal protein L28 4932
108 6D9J 26 a uL15 9986
109 6D90 26 a uL15 9986
110 6FTG 26 a uL15 9986
111 6FTI 26 a uL15 9986
112 6FTJ 26 a uL15 9986
113 6FT6 27 a 60S ribosomal protein L28 4932
114 6FRK 34 a Ribosomal protein uL15 9986
115 6ELZ 22 a 60S ribosomal protein L28 4932
116 6EK0 29 La 60S ribosomal protein L27a 9606
117 6AZ3 12 L ribosomal protein uL15 5661
118 5XY3 29 a Uncharacterized protein 5722
119 5XXB 29 Z Ribosomal protein uL15 5811
120 5UMD 15 O 60S ribosomal protein L27a, putative 5833
121 5MC6 58 AR 60S ribosomal protein L28 4932
122 5H4P 28 a 60S ribosomal protein L28 4932
123 5M1J 39 a5 60S ribosomal protein L28 4932
124 5LZS 26 a uL15 9986
125 5LZT 26 a uL15 9986
126 5LZU 26 a uL15 9986
127 5LZV 26 a uL15 9986
128 5LZW 26 a uL15 9986
129 5LZX 26 a uL15 9986
130 5LZY 26 a uL15 9986
131 5LZZ 26 a uL15 9986
132 5T62 30 n 60S ribosomal protein L28 4932
133 5T6R 29 n 60S ribosomal protein L28 4932
134 5T5H 25 b 60S ribosomal protein L27A/L29 5693
135 5T2A 26 Z uL15 5661
136 5T2C 16 U 60S ribosomal protein L27a 9606
137 5LKS 29 La 60S ribosomal protein L27a 9606
138 5JUO 32 FA uL15 (yeast L28) 4932
139 5JUP 32 FA uL15 (yeast L28) 4932
140 5JUS 32 FA uL15 (yeast L28) 4932
141 5JUT 32 FA uL15 (yeast L28) 4932
142 5JUU 32 FA uL15 (yeast L28) 4932
143 5JCS 48 a 60S ribosomal protein L28 4932
144 5IT7 29 aa RPL28 28985
145 3JCT 27 a 60S ribosomal protein L28 4932
146 3JCS 20 L ribosomal protein L15 5661
147 5GAK 12 c 60S ribosomal protein L28 4932
148 5FL8 26 a 60S ribosomal protein L28 4932
149 5APN 29 a 60S ribosomal protein L28 4932
150 5APO 29 a 60S ribosomal protein L28 4932
151 3JBN 60 AO 60S ribosomal protein uL15 5833
152 3JBO 39 AO 60S ribosomal protein uL15 5833
153 3JBP 60 AO 60S ribosomal protein uL15 5833
154 3JAN 19 a Ribosomal protein uL15 SEE REMARK 999 9986
155 3JAJ 19 a Ribosomal protein uL15 SEE REMARK 999 9986
156 3JAG 26 a uL15 9986
157 3JAH 26 a uL15 9986
158 3JAI 26 a uL15 9986
159 4UG0 29 La 60S RIBOSOMAL PROTEIN L27A 9606
160 5AJ0 29 Aa 60S ribosomal protein L27a 9606
161 3J92 26 a uL15 9986
162 4D67 26 a 60S RIBOSOMAL PROTEIN L27A 9986
163 4D5Y 26 a 60S RIBOSOMAL PROTEIN UL15 9986
164 4V3P 43 LO 60S ribosomal protein L27a-3 4565
165 3J7O 29 a Ribosomal protein uL15 9823
166 3J7P 30 a Ribosomal protein uL15 9823
167 3J7Q 29 a Ribosomal protein uL15 9823
168 3J7R 29 a Ribosomal protein uL15 9823
169 4UJC 32 Ba 60S RIBOSOMAL PROTEIN L27A 9986
170 4UJD 29 Aa 60S RIBOSOMAL PROTEIN L27A 9986
171 3J79 15 O 60S ribosomal protein uL15 5833
172 3J77 28 78 60S ribosomal protein L28 4932
173 3J78 28 78 60S ribosomal protein L28 4932
174 3J6X 30 68 60S ribosomal protein L28 4932
175 3J6Y 30 68 60S ribosomal protein L28 4932
176 4UJE 63 Ca 60S RIBOSOMAL PROTEIN L27A 9986
177 4V91 29 a UL15 RIBOSOMAL PROTEIN UL15 28985
178 4V7F 17 N 60S ribosomal protein L28 4932
179 4V7E 46 Ca 60S ribosomal protein L15 4565
180 4V8Y 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
181 4V8Z 61 Ba 60S RIBOSOMAL PROTEIN L28 4932
182 4V6W 45 Ca 60S ribosomal protein L27a 7227
183 4V6X 45 Ca 60S ribosomal protein L27a 9606
184 4V8M 61 Bb 60S RIBOSOMAL PROTEIN L27A 185431
185 4V8T 27 a 60S RIBOSOMAL PROTEIN L28 4932
186 4V6I 44 BO 60S ribosomal protein rpL28 (L15p) 4932
187 4V7H 46 BV 60S ribosomal protein L28 5541
188 4V5Z 64 Bl 60S Ribosomal protein L27a 9612
189 4V4B 41 BV 60S ribosomal protein L28 4932