5VYC

Crystal structure of the human 40S ribosomal subunit in complex with DENR-MCT-1.


Sequence Similarity Clusters for the Entities in PDB 5VYC

Entity #1 | Chains: T1,T2,T3,T4,T5,T6
40S ribosomal protein S19 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 43 1084
95 % 1 85 693
90 % 1 85 724
70 % 1 85 757
50 % 1 87 768
40 % 1 87 798
30 % 3 90 775
Entity #10 | Chains: C1,C2,C3,C4,C5,C6
40S ribosomal protein S2 protein, length: 293 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 27 1823
95 % 1 40 1577
90 % 1 52 1240
70 % 1 53 1258
50 % 1 56 1235
40 % 1 56 1261
30 % 1 56 1302
Entity #11 | Chains: G1,G2,G3,G4,G5,G6
40S ribosomal protein S6 protein, length: 249 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 529
95 % 1 85 698
90 % 1 85 729
70 % 1 91 702
50 % 39 182 294
40 % 39 187 294
30 % 39 187 311
Entity #12 | Chains: J1,J2,J3,J4,J5,J6
40S ribosomal protein S9 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 521
95 % 1 85 687
90 % 1 85 715
70 % 39 185 251
50 % 41 200 237
40 % 41 208 236
30 % 41 208 249
Entity #13 | Chains: M1,M2,M3,M4,M5,M6
40S ribosomal protein S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 64 712
95 % 1 77 768
90 % 1 77 806
70 % 1 82 783
50 % 1 83 808
40 % 1 83 838
30 % 1 83 882
Entity #14 | Chains: N1,N2,N3,N4,N5,N6
40S ribosomal protein S13 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 513
95 % 1 85 685
90 % 1 85 714
70 % 39 190 248
50 % 41 197 246
40 % 41 205 240
30 % 41 206 251
Entity #15 | Chains: O1,O2,O3,O4,O5,O6
40S ribosomal protein S14 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 73 612
95 % 1 73 820
90 % 1 81 773
70 % 41 198 231
50 % 41 199 238
40 % 41 199 250
30 % 41 199 262
Entity #16 | Chains: W1,W2,W3,W4,W5,W6
40S ribosomal protein S15a protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 509
95 % 1 86 677
90 % 1 86 706
70 % 42 203 225
50 % 42 204 230
40 % 43 214 230
30 % 391 808 22
Entity #17 | Chains: Y1,Y2,Y3,Y4,Y5,Y6
40S ribosomal protein S24 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 576
95 % 1 85 690
90 % 1 85 717
70 % 1 86 737
50 % 38 192 266
40 % 38 192 280
30 % 38 192 293
Entity #18 | Chains: Z1,Z2,Z3,Z4,Z5,Z6
40S ribosomal protein S25 protein, length: 125 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 57 810
95 % 1 57 1098
90 % 1 57 1137
70 % 1 58 1150
50 % 1 58 1208
40 % 1 59 1214
30 % 1 59 1256
Entity #19 | Chains: b1,b2,b3,b4,b5,b6
40S ribosomal protein S27 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 520
95 % 1 85 683
90 % 1 85 713
70 % 38 175 271
50 % 40 187 269
40 % 40 187 285
30 % 40 187 298
Entity #2 | Chains: U1,U2,U3,U4,U5,U6
40S ribosomal protein S20 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 887
95 % 1 56 1105
90 % 1 56 1149
70 % 1 57 1172
50 % 1 59 1164
40 % 1 59 1195
30 % 1 59 1237
Entity #20 | Chains: e1,e2,e3,e4,e5,e6
40S ribosomal protein S30 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 13142
95 % 1 31 1949
90 % 1 31 2011
70 % 1 31 2072
50 % 1 32 2082
40 % 1 32 2111
30 % 1 32 2144
Entity #21 | Chains: i1,i2,i3,i4,i5,i6
Human 18S ribosomal RNA rna, length: 1869 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: A1,A2,A3,A4,A5,A6
40S ribosomal protein SA protein, length: 295 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1880
95 % 1 54 1167
90 % 1 54 1206
70 % 1 54 1240
50 % 1 54 1283
40 % 1 54 1314
30 % 1 54 1353
Entity #23 | Chains: B1,B2,B3,B4,B5,B6
40S ribosomal protein S3a protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 925
95 % 1 58 1078
90 % 1 58 1119
70 % 1 58 1151
50 % 1 60 1156
40 % 40 161 340
30 % 40 161 361
Entity #24 | Chains: D1,D2,D3,D4,D5,D6
40S ribosomal protein S3 protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 41 1143
95 % 1 73 821
90 % 1 73 853
70 % 1 74 877
50 % 40 168 321
40 % 40 168 336
30 % 40 168 353
Entity #25 | Chains: E1,E2,E3,E4,E5,E6
40S ribosomal protein S4, X isoform protein, length: 263 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 883
95 % 1 73 812
90 % 1 85 712
70 % 38 181 261
50 % 40 191 255
40 % 40 191 267
30 % 40 199 267
Entity #26 | Chains: F1,F2,F3,F4,F5,F6
40S ribosomal protein S5 protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 505
95 % 1 86 679
90 % 1 86 707
70 % 1 101 624
50 % 41 201 235
40 % 41 201 246
30 % 41 201 260
Entity #27 | Chains: H1,H2,H3,H4,H5,H6
40S ribosomal protein S7 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 530
95 % 1 85 696
90 % 1 85 727
70 % 1 86 740
50 % 38 188 273
40 % 38 188 288
30 % 40 191 283
Entity #28 | Chains: I1,I2,I3,I4,I5,I6
40S ribosomal protein S8 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 577
95 % 1 85 702
90 % 1 85 736
70 % 1 85 756
50 % 40 190 259
40 % 40 194 262
30 % 40 194 275
Entity #29 | Chains: K1,K2,K3,K4,K5,K6
40S ribosomal protein S10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 919
95 % 1 53 1192
90 % 1 53 1215
70 % 1 53 1269
50 % 1 54 1273
40 % 1 55 1305
30 % 1 55 1339
Entity #3 | Chains: V1,V2,V3,V4,V5,V6
40S ribosomal protein S21 protein, length: 83 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 65 704
95 % 1 84 704
90 % 1 84 743
70 % 1 85 747
50 % 38 176 306
40 % 38 176 320
30 % 38 176 337
Entity #30 | Chains: L1,L2,L3,L4,L5,L6
40S ribosomal protein S11 protein, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 508
95 % 1 86 676
90 % 1 86 705
70 % 1 87 733
50 % 41 197 245
40 % 41 197 256
30 % 41 197 268
Entity #31 | Chains: P1,P2,P3,P4,P5,P6
40S ribosomal protein S15 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 31 1561
95 % 1 84 709
90 % 1 84 745
70 % 1 86 745
50 % 40 179 299
40 % 40 186 292
30 % 40 187 306
Entity #32 | Chains: Q1,Q2,Q3,Q4,Q5,Q6
40S ribosomal protein S16 protein, length: 146 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 76 587
95 % 1 76 784
90 % 1 76 826
70 % 1 79 818
50 % 41 190 253
40 % 41 198 255
30 % 41 199 263
Entity #33 | Chains: R1,R2,R3,R4,R5,R6
40S ribosomal protein S17 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 29 1663
95 % 1 85 691
90 % 1 85 718
70 % 1 86 738
50 % 40 176 301
40 % 40 176 313
30 % 40 176 332
Entity #34 | Chains: S1,S2,S3,S4,S5,S6
40S ribosomal protein S18 protein, length: 152 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 506
95 % 1 86 680
90 % 1 86 708
70 % 39 183 254
50 % 41 192 251
40 % 41 202 243
30 % 41 202 257
Entity #35 | Chains: j1,j2,j3,j4,j5,j6
60S ribosomal protein L41 protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 557
95 % 1 82 722
90 % 1 82 761
70 % 38 163 284
50 % 38 163 331
40 % 38 163 348
30 % 38 163 365
Entity #36 | Chains: k1,k2,k3,k4,k5,k6
Malignant T-cell-amplified sequence 1 protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 12031
95 % 4 4 4080
90 % 4 4 4242
70 % 4 4 4116
50 % 4 4 4153
40 % 4 4 3997
30 % 4 4 4007
Entity #37 | Chains: l1,l2,l3,l4,l5,l6
Density-regulated protein protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 5443
95 % 3 3 6028
90 % 3 3 6227
70 % 3 3 6115
50 % 3 3 5869
40 % 3 3 5589
30 % 3 3 5343
Entity #4 | Chains: X1,X2,X3,X4,X5,X6
40S ribosomal protein S23 protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 526
95 % 1 88 660
90 % 1 89 687
70 % 41 204 222
50 % 41 214 220
40 % 41 214 231
30 % 41 214 240
Entity #5 | Chains: a1,a2,a3,a4,a5,a6
40S ribosomal protein S26 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 35 1336
95 % 1 49 1281
90 % 1 49 1318
70 % 1 50 1322
50 % 3 81 779
40 % 5 83 757
30 % 5 83 792
Entity #6 | Chains: c1,c2,c3,c4,c5,c6
40S ribosomal protein S28 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 67 676
95 % 1 67 918
90 % 1 67 961
70 % 39 191 247
50 % 41 202 232
40 % 41 203 242
30 % 41 203 254
Entity #7 | Chains: d1,d2,d3,d4,d5,d6
40S ribosomal protein S29 protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 560
95 % 1 83 711
90 % 1 83 747
70 % 39 169 280
50 % 39 177 302
40 % 39 177 314
30 % 39 177 333
Entity #8 | Chains: f1,f2,f3,f4,f5,f6
Ribosomal protein S27a protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 11798
95 % 1 50 1265
90 % 1 50 1297
70 % 4 82 729
50 % 6 86 728
40 % 6 89 734
30 % 6 89 768
Entity #9 | Chains: g1,g2,g3,g4,g5,g6
Receptor of activated protein C kinase 1 protein, length: 317 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 85 500
95 % 2 85 669
90 % 2 85 700
70 % 3 87 713
50 % 46 176 281
40 % 48 182 274
30 % 48 183 285

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
33 4BTS 21 AK, BK, CK, DK 40S RIBOSOMAL PROTEIN RPS14E 5911
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6YAL 17 Q 40S ribosomal protein uS11 9986
46 6YAM 17 Q 40S ribosomal protein uS11 9986
47 6YAN 16 Q 40S ribosomal protein uS11 9986
48 6W2S 13 P uS11 9986
49 6W2T 12 P uS11 9986
50 6Y7C 14 O 40S ribosomal protein S14-A 4932
51 6Y57 63 SO 40S ribosomal protein S14 9606
52 6Y2L 63 SO 40S ribosomal protein S14 9606
53 6Y0G 64 SO 40S ribosomal protein S14 9606
54 6TNU 18 Z 40S ribosomal protein S14-B 4932
55 6UZ7 62 O 40S ribosomal protein S14 28985
56 6TB3 18 Z 40S ribosomal protein S14-B 4932
57 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
58 6T7T 19 SO 40S ribosomal protein S14-B 4932
59 6T7I 17 SO 40S ribosomal protein S14-A 4932
60 6T4Q 16 SO 40S ribosomal protein S14-B 4932
61 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
62 6SNT 17 O 40S ribosomal protein S14-A 4932
63 6SGC 16 P1 uS11 9986
64 6S47 60 BP 40S ribosomal protein S14-A 4932
65 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
66 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
67 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
68 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
69 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
70 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
71 6P5I 16 P uS11 9986
72 6P5J 16 P uS11 9986
73 6P5K 62 P uS11 9986
74 6P5N 62 P uS11 9986
75 6P4G 16 P uS11 9986
76 6P4H 17 P uS11 9986
77 6OM7 28 SO 40S ribosomal protein S14 9606
78 6OLZ 61 BO 40S ribosomal protein S14 9606
79 6OM0 28 SO 40S ribosomal protein S14 9606
80 6OLE 28 SO 40S ribosomal protein S14 9606
81 6OLF 28 SO 40S ribosomal protein S14 9606
82 6OLG 64 BO 40S ribosomal protein S14 9606
83 6OLI 28 SO 40S ribosomal protein S14 9606
84 6OKK 16 P 40S ribosomal protein S11 5833
85 6RBD 27 O 40S ribosomal protein S14-A 4932
86 6RBE 12 O 40S ribosomal protein S14-A 4932
87 6R7Q 13 MM uS11 9986
88 6R6G 36 MM 40S ribosomal protein S14 9986
89 6R6P 62 MM uS11 9986
90 6R5Q 66 MM uS11 9986
91 6QZP 75 SO 40S ribosomal protein S14 9606
92 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
93 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
94 6IP5 74 3L 40S ribosomal protein S14 9606
95 6IP6 73 3L 40S ribosomal protein S14 9606
96 6IP8 73 3L 40S ribosomal protein S14 9606
97 6MTB 65 OO 40S ribosomal protein S14 9986
98 6MTC 64 OO 40S ribosomal protein S14 9986
99 6MTD 66 OO uS11 9986
100 6MTE 65 OO uS11 9986
101 6HCQ 19 P2 uS11 9986
102 6HCJ 19 P2 uS11 9986
103 6HCM 16 P1 uS11 9986
104 6HCF 16 P1 uS11 9986
105 6GZ3 31 BO ribosomal protein uS11 9986
106 6GZ4 34 BO ribosomal protein uS11 9986
107 6GZ5 31 BO ribosomal protein uS11 9986
108 6GSM 18 O 40S ribosomal protein S14 28985
109 6GSN 38 O 40S ribosomal protein S14 28985
110 6GQV 62 AE 40S ribosomal protein S14-B 4932
111 6GQ1 62 AE 40S ribosomal protein S14-B 4932
112 6GQB 62 AE 40S ribosomal protein S14-B 4932
113 6D9J 64 PP uS11 9986
114 6D90 65 PP uS11 9986
115 6G5H 12 O 40S ribosomal protein S14 9606
116 6G5I 16 O 40S ribosomal protein S14 9606
117 6G4S 27 O 40S ribosomal protein S14 9606
118 6G4W 23 O 40S ribosomal protein S14 9606
119 6G51 13 O 40S ribosomal protein S14 9606
120 6G53 13 O 40S ribosomal protein S14 9606
121 6G18 23 O 40S ribosomal protein S14 9606
122 6FYX 18 O 40S ribosomal protein S14 28985
123 6FYY 18 O 40S ribosomal protein S14 28985
124 6FEC 38 j 40S ribosomal protein S14 9606
125 6FAI 25 O 40S ribosomal protein S14-A 4932
126 6EML 22 Z 40S ribosomal protein S14-A 4932
127 6EK0 75 SO 40S ribosomal protein S14 9606
128 6AZ1 15 O ribosomal protein S11 5661
129 5OQL 42 t 40S ribosomal protein S14-like protein 209285
130 5OPT 14 V 40S ribosomal protein S14, putative 5693
131 5WLC 40 NG rpS14_uS11 4932
132 5XYI 16 O Ribosomal protein S14 5722
133 5XXU 16 O Ribosomal protein uS11 5811
134 5OA3 19 O 40S ribosomal protein S14 9606
135 5WYJ 45 SP 40S ribosomal protein S14-A 4932
136 5WYK 41 SP 40S ribosomal protein S14-A 4932
137 5MC6 27 Z 40S ribosomal protein S14-A 4932
138 5M1J 22 O2 40S ribosomal protein S14-A 4932
139 5LZS 65 OO uS11 9986
140 5LZT 66 OO uS11 9986
141 5LZU 65 OO uS11 9986
142 5LZV 66 OO uS11 9986
143 5LZW 66 OO uS11 9986
144 5LZX 66 OO uS11 9986
145 5LZY 64 OO uS11 9986
146 5LZZ 66 OO uS11 9986
147 5T2A 63 AH uS11 5661
148 5T2C 80 AO 40S ribosomal protein S14 9606
149 5LL6 12 Z 40S ribosomal protein S14-A 4932
150 5LKS 74 SO 40S ribosomal protein S14 9606
151 5K0Y 32 j ribosomal protein uS11 9986
152 5JUO 64 LB uS11 (yeast S14) 4932
153 5JUP 64 LB uS11 (yeast S14) 4932
154 5JUS 64 LB uS11 (yeast S14) 4932
155 5JUT 64 LB uS11 (yeast S14) 4932
156 5JUU 64 LB uS11 (yeast S14) 4932
157 5JPQ 29 w uS11 209285
158 5IT7 62 O 40S ribosomal protein S14 28985
159 5IT9 15 O Ribosomal protein uS14 28985
160 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
161 3JAP 18 O uS11 28985
162 3JAQ 18 O uS11 28985
163 3JAM 16 O uS11 28985
164 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
165 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
166 3JAG 66 OO uS11 9986
167 3JAH 66 OO uS11 9986
168 3JAI 66 OO uS11 9986
169 5A2Q 17 O RIBOSOMAL PROTEIN US11 9606
170 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
171 5AJ0 64 BO 40S ribosomal protein S14 9606
172 4UER 21 K US11 4934
173 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
174 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
175 3J81 16 O uS11 28985
176 3J80 12 O uS11 28985
177 3J7P 64 SO Ribosomal protein uS11 9823
178 3J7R 65 SO Ribosomal protein uS11 9823
179 4UJC 65 CO 40S RIBOSOMAL PROTEIN US11 9986
180 4UJD 65 CO 40S RIBOSOMAL PROTEIN ES11 9986
181 3J7A 16 P 40S ribosomal protein uS11 5833
182 3J77 60 14 40S ribosomal protein S14 4932
183 3J78 60 14 40S ribosomal protein S14 4932
184 3J6X 61 14 40S ribosomal protein S14 4932
185 3J6Y 61 14 40S ribosomal protein S14 4932
186 4UJE 19 BO 40S RIBOSOMAL PROTEIN S14 9986
187 4V92 17 BO US11 28985
188 4V7E 16 BO 40S ribosomal protein S11 4565
189 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
190 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
191 4V6W 5 AO 40S ribosomal protein S14 7227
192 4V6X 5 AO 40S ribosomal protein S14 9606
193 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
194 3J0O 12 K Ribosomal protein S14 9986
195 3J0L 12 K Ribosomal protein S14 9986
196 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
197 4V7H 10 AK 40S ribosomal protein S14(A) 5541
198 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
199 4V4B 11 AK 40S ribosomal protein S14-A 4932