Crystal structure of the human 40S ribosomal subunit in complex with DENR-MCT-1.

Sequence Similarity Clusters for the Entities in PDB 5VYC

Entity #1 | Chains: T1,T2,T3,T4,T5,T6
40S ribosomal protein S19 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 43 1080
95 % 1 85 698
90 % 1 85 721
70 % 1 85 752
50 % 1 87 764
40 % 1 87 792
30 % 3 90 775
Entity #10 | Chains: C1,C2,C3,C4,C5,C6
40S ribosomal protein S2 protein, length: 293 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 27 1779
95 % 1 40 1578
90 % 1 52 1239
70 % 1 53 1258
50 % 1 56 1236
40 % 1 56 1274
30 % 1 56 1308
Entity #11 | Chains: G1,G2,G3,G4,G5,G6
40S ribosomal protein S6 protein, length: 249 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 527
95 % 1 85 689
90 % 1 85 723
70 % 1 91 698
50 % 39 182 296
40 % 39 187 289
30 % 39 187 306
Entity #12 | Chains: J1,J2,J3,J4,J5,J6
40S ribosomal protein S9 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 515
95 % 1 85 683
90 % 1 85 710
70 % 39 185 250
50 % 41 200 236
40 % 41 208 236
30 % 41 208 246
Entity #13 | Chains: M1,M2,M3,M4,M5,M6
40S ribosomal protein S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 64 716
95 % 1 77 766
90 % 1 77 807
70 % 1 82 778
50 % 1 83 805
40 % 1 83 833
30 % 1 83 871
Entity #14 | Chains: N1,N2,N3,N4,N5,N6
40S ribosomal protein S13 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 518
95 % 1 85 690
90 % 1 85 709
70 % 39 190 248
50 % 41 197 246
40 % 41 205 239
30 % 41 206 248
Entity #15 | Chains: O1,O2,O3,O4,O5,O6
40S ribosomal protein S14 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 73 607
95 % 1 73 820
90 % 1 81 765
70 % 41 198 227
50 % 41 199 238
40 % 41 199 247
30 % 41 199 259
Entity #16 | Chains: W1,W2,W3,W4,W5,W6
40S ribosomal protein S15a protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 502
95 % 1 86 679
90 % 1 86 704
70 % 40 201 234
50 % 42 203 231
40 % 43 212 230
30 % 391 808 23
Entity #17 | Chains: Y1,Y2,Y3,Y4,Y5,Y6
40S ribosomal protein S24 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 576
95 % 1 85 701
90 % 1 85 733
70 % 1 86 738
50 % 38 192 267
40 % 38 192 280
30 % 38 192 292
Entity #18 | Chains: Z1,Z2,Z3,Z4,Z5,Z6
40S ribosomal protein S25 protein, length: 125 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 57 813
95 % 1 57 1086
90 % 1 57 1129
70 % 1 58 1151
50 % 1 58 1192
40 % 1 59 1213
30 % 1 59 1257
Entity #19 | Chains: b1,b2,b3,b4,b5,b6
40S ribosomal protein S27 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 517
95 % 1 85 696
90 % 1 85 716
70 % 38 175 270
50 % 40 187 268
40 % 40 187 281
30 % 40 187 295
Entity #2 | Chains: U1,U2,U3,U4,U5,U6
40S ribosomal protein S20 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 885
95 % 1 56 1104
90 % 1 56 1149
70 % 1 57 1170
50 % 1 59 1162
40 % 1 59 1193
30 % 1 59 1234
Entity #20 | Chains: e1,e2,e3,e4,e5,e6
40S ribosomal protein S30 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 13434
95 % 1 31 1996
90 % 1 31 2014
70 % 1 31 2066
50 % 1 32 2068
40 % 1 32 2095
30 % 1 32 2126
Entity #21 | Chains: i1,i2,i3,i4,i5,i6
Human 18S ribosomal RNA rna, length: 1869 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: A1,A2,A3,A4,A5,A6
40S ribosomal protein SA protein, length: 295 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1879
95 % 1 54 1162
90 % 1 54 1208
70 % 1 54 1235
50 % 1 54 1283
40 % 1 54 1312
30 % 1 54 1357
Entity #23 | Chains: B1,B2,B3,B4,B5,B6
40S ribosomal protein S3a protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 920
95 % 1 58 1081
90 % 1 58 1122
70 % 1 58 1159
50 % 1 60 1153
40 % 40 161 336
30 % 40 161 355
Entity #24 | Chains: D1,D2,D3,D4,D5,D6
40S ribosomal protein S3 protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 41 1136
95 % 1 73 815
90 % 1 73 847
70 % 1 74 875
50 % 40 168 323
40 % 40 168 332
30 % 40 168 349
Entity #25 | Chains: E1,E2,E3,E4,E5,E6
40S ribosomal protein S4, X isoform protein, length: 263 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 875
95 % 1 73 819
90 % 1 85 718
70 % 38 181 261
50 % 40 191 255
40 % 40 195 258
30 % 40 204 254
Entity #26 | Chains: F1,F2,F3,F4,F5,F6
40S ribosomal protein S5 protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 507
95 % 1 86 676
90 % 1 86 701
70 % 1 101 616
50 % 41 201 234
40 % 41 201 244
30 % 41 201 258
Entity #27 | Chains: H1,H2,H3,H4,H5,H6
40S ribosomal protein S7 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 521
95 % 1 85 693
90 % 1 85 725
70 % 1 86 737
50 % 38 188 272
40 % 38 188 285
30 % 40 191 282
Entity #28 | Chains: I1,I2,I3,I4,I5,I6
40S ribosomal protein S8 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 571
95 % 1 85 682
90 % 1 85 711
70 % 1 85 746
50 % 40 190 260
40 % 40 194 260
30 % 40 194 272
Entity #29 | Chains: K1,K2,K3,K4,K5,K6
40S ribosomal protein S10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 925
95 % 1 53 1173
90 % 1 53 1215
70 % 1 53 1245
50 % 1 54 1269
40 % 1 55 1283
30 % 1 55 1318
Entity #3 | Chains: V1,V2,V3,V4,V5,V6
40S ribosomal protein S21 protein, length: 83 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 65 701
95 % 1 84 708
90 % 1 84 737
70 % 1 85 750
50 % 38 171 317
40 % 38 171 327
30 % 38 171 341
Entity #30 | Chains: L1,L2,L3,L4,L5,L6
40S ribosomal protein S11 protein, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 497
95 % 1 86 673
90 % 1 86 702
70 % 1 87 729
50 % 41 197 244
40 % 41 197 253
30 % 41 197 264
Entity #31 | Chains: P1,P2,P3,P4,P5,P6
40S ribosomal protein S15 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 31 1548
95 % 1 84 705
90 % 1 84 739
70 % 1 86 741
50 % 40 179 302
40 % 40 187 286
30 % 40 187 304
Entity #32 | Chains: Q1,Q2,Q3,Q4,Q5,Q6
40S ribosomal protein S16 protein, length: 146 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 76 585
95 % 1 76 784
90 % 1 76 818
70 % 1 79 812
50 % 41 190 253
40 % 41 198 249
30 % 41 199 260
Entity #33 | Chains: R1,R2,R3,R4,R5,R6
40S ribosomal protein S17 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 29 1666
95 % 1 85 691
90 % 1 85 724
70 % 1 86 743
50 % 40 176 304
40 % 40 176 310
30 % 40 176 327
Entity #34 | Chains: S1,S2,S3,S4,S5,S6
40S ribosomal protein S18 protein, length: 152 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 496
95 % 1 86 672
90 % 1 86 700
70 % 39 183 254
50 % 41 192 252
40 % 41 202 242
30 % 41 202 255
Entity #35 | Chains: j1,j2,j3,j4,j5,j6
60S ribosomal protein L41 protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 554
95 % 1 82 724
90 % 1 82 756
70 % 38 163 284
50 % 38 163 334
40 % 38 163 344
30 % 38 163 361
Entity #36 | Chains: k1,k2,k3,k4,k5,k6
Malignant T-cell-amplified sequence 1 protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 11984
95 % 4 4 4065
90 % 4 4 4116
70 % 4 4 4092
50 % 4 4 4034
40 % 4 4 3988
30 % 4 4 3898
Entity #37 | Chains: l1,l2,l3,l4,l5,l6
Density-regulated protein protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 5346
95 % 3 3 6334
90 % 3 3 6429
70 % 3 3 6325
50 % 3 3 6068
40 % 3 3 5909
30 % 3 3 5621
Entity #4 | Chains: X1,X2,X3,X4,X5,X6
40S ribosomal protein S23 protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 522
95 % 1 88 659
90 % 1 89 677
70 % 41 204 222
50 % 41 214 221
40 % 41 214 227
30 % 41 214 235
Entity #5 | Chains: a1,a2,a3,a4,a5,a6
40S ribosomal protein S26 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 35 1334
95 % 1 49 1287
90 % 1 49 1326
70 % 1 50 1327
50 % 3 81 780
40 % 5 83 753
30 % 5 83 786
Entity #6 | Chains: c1,c2,c3,c4,c5,c6
40S ribosomal protein S28 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 67 678
95 % 1 67 906
90 % 1 67 941
70 % 39 191 247
50 % 41 202 232
40 % 41 203 241
30 % 41 203 252
Entity #7 | Chains: d1,d2,d3,d4,d5,d6
40S ribosomal protein S29 protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 557
95 % 1 83 712
90 % 1 83 750
70 % 39 168 281
50 % 41 176 294
40 % 41 176 305
30 % 41 176 325
Entity #8 | Chains: f1,f2,f3,f4,f5,f6
Ribosomal protein S27a protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 12188
95 % 1 50 1258
90 % 1 50 1295
70 % 4 82 724
50 % 6 86 729
40 % 6 89 728
30 % 6 89 758
Entity #9 | Chains: g1,g2,g3,g4,g5,g6
Receptor of activated protein C kinase 1 protein, length: 317 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 85 495
95 % 2 85 663
90 % 2 85 693
70 % 3 87 711
50 % 46 180 280
40 % 48 182 271
30 % 48 183 283


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 16 AO, CO 40S ribosomal protein S14-A 4932
2 4U4R 16 C4, c4 40S ribosomal protein S14-A 4932
3 4U3U 16 C4, c4 40S ribosomal protein S14-A 4932
4 5TBW 63 P, c4 40S ribosomal protein S14-B 4932
5 4U3M 16 C4, c4 40S ribosomal protein S14-A 4932
6 4U3N 16 C4, c4 40S ribosomal protein S14-A 4932
7 4U52 16 C4, c4 40S ribosomal protein S14-A 4932
8 4U4Q 16 C4, c4 40S ribosomal protein S14-A 4932
9 4U6F 16 C4, c4 40S ribosomal protein S14-A 4932
10 4U4U 16 C4, c4 40S ribosomal protein S14-A 4932
11 4U4Z 16 C4, c4 40S ribosomal protein S14-A 4932
12 4U4Y 16 C4, c4 40S ribosomal protein S14-A 4932
13 4U4N 16 C4, c4 40S ribosomal protein S14-A 4932
14 4U55 16 C4, c4 40S ribosomal protein S14-A 4932
15 5DAT 16 C4, c4 40S ribosomal protein S14-A 4932
16 5I4L 16 C4, c4 40S ribosomal protein S14-B 4932
17 4U51 16 C4, c4 40S ribosomal protein S14-A 4932
18 6HHQ 62 P, c4 40S ribosomal protein S14-B 4932
19 5OBM 60 C4, c4 40S ribosomal protein S14-B 4932
20 4U53 16 C4, c4 40S ribosomal protein S14-A 4932
21 5ON6 64 P, c4 40S ribosomal protein S14-B 4932
22 4U50 16 C4, c4 40S ribosomal protein S14-A 4932
23 5NDV 60 C4, c4 40S ribosomal protein S14-B 4932
24 5LYB 16 C4, c4 40S Ribosomal Protein S14 4932
25 4U56 16 C4, c4 40S ribosomal protein S14-A 4932
26 5TGA 16 C4, c4 40S ribosomal protein S14-B 4932
27 5MEI 63 P, c4 40S ribosomal protein S14-B 4932
28 5FCJ 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
29 4U4O 16 C4, c4 40S ribosomal protein S14-A 4932
30 5DGV 16 C4, c4 40S ribosomal protein S14-A 4932
31 5DGE 16 C4, c4 40S ribosomal protein S14-A 4932
32 5NDW 9 C4, c4 40S ribosomal protein S14-B 4932
34 5NDG 16 C4, c4 40S ribosomal protein S14-A 4932
35 5FCI 16 C4, c4 40S ribosomal protein S14-A (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHV KIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL 4932
36 5DC3 16 C4, c4 40S ribosomal protein S14-A 4932
37 5DGF 16 C4, c4 40S ribosomal protein S14-A 4932
38 4V5O 20 AK, BK RPS14E 5911
39 5TGM 16 C4, c4 40S ribosomal protein S14-A 4932
40 4V7R 9 AH, CH 40S ribosomal protein S14-A 4932
41 5VYC 15 O1, O2, O3, O4, O5, O6 40S ribosomal protein S14 9606
42 4KZZ 15 O 40S Ribosomal Protein S14 9986
43 4KZX 15 O 40S ribosomal protein S14 9986
44 4KZY 15 O 40S Ribosomal Protein S14 9986
45 6YAL 17 Q 40S ribosomal protein uS11 9986
46 6YAM 17 Q 40S ribosomal protein uS11 9986
47 6YAN 16 Q 40S ribosomal protein uS11 9986
48 6W2S 13 P uS11 9986
49 6W2T 12 P uS11 9986
50 6Y7C 14 O 40S ribosomal protein S14-A 4932
51 6Y57 63 SO 40S ribosomal protein S14 9606
52 6Y2L 63 SO 40S ribosomal protein S14 9606
53 6Y0G 64 SO 40S ribosomal protein S14 9606
54 6TNU 18 Z 40S ribosomal protein S14-B 4932
55 6UZ7 62 O 40S ribosomal protein S14 28985
56 6TB3 18 Z 40S ribosomal protein S14-B 4932
57 6T83 17 Ob, p 40S ribosomal protein S14-A 4932
58 6T7T 19 SO 40S ribosomal protein S14-B 4932
59 6T7I 17 SO 40S ribosomal protein S14-A 4932
60 6T4Q 16 SO 40S ribosomal protein S14-B 4932
61 6SV4 33 Z, Zb, Zc 40S ribosomal protein S14-A 4932
62 6SNT 17 O 40S ribosomal protein S14-A 4932
63 6SGC 16 P1 uS11 9986
64 6S47 60 BP 40S ribosomal protein S14-A 4932
65 6RXT 39 Ci 40S ribosomal protein S14-like protein 209285
66 6RXU 42 Ci 40S ribosomal protein S14-like protein 209285
67 6RXV 42 Ci 40S ribosomal protein S14-like protein 209285
68 6RXX 24 Ci 40S ribosomal protein S14-like protein 209285
69 6RXY 38 Ci 40S ribosomal protein S14-like protein 209285
70 6RXZ 41 Ci 40S ribosomal protein S14-like protein 209285
71 6P5I 16 P uS11 9986
72 6P5J 16 P uS11 9986
73 6P5K 62 P uS11 9986
74 6P5N 62 P uS11 9986
75 6P4G 16 P uS11 9986
76 6P4H 17 P uS11 9986
77 6OM7 28 SO 40S ribosomal protein S14 9606
78 6OLZ 61 BO 40S ribosomal protein S14 9606
79 6OM0 28 SO 40S ribosomal protein S14 9606
80 6OLE 28 SO 40S ribosomal protein S14 9606
81 6OLF 28 SO 40S ribosomal protein S14 9606
82 6OLG 64 BO 40S ribosomal protein S14 9606
83 6OLI 28 SO 40S ribosomal protein S14 9606
84 6OKK 16 P 40S ribosomal protein S11 5833
85 6RBD 27 O 40S ribosomal protein S14-A 4932
86 6RBE 12 O 40S ribosomal protein S14-A 4932
87 6R7Q 13 MM uS11 9986
88 6R6G 36 MM 40S ribosomal protein S14 9986
89 6R6P 62 MM uS11 9986
90 6R5Q 66 MM uS11 9986
91 6QZP 75 SO 40S ribosomal protein S14 9606
92 6Q8Y 81 Z 40S ribosomal protein S14-B 4932
93 6I7O 33 Z, Zb 40S ribosomal protein S14-B 4932
94 6IP5 74 3L 40S ribosomal protein S14 9606
95 6IP6 73 3L 40S ribosomal protein S14 9606
96 6IP8 73 3L 40S ribosomal protein S14 9606
97 6MTB 65 OO 40S ribosomal protein S14 9986
98 6MTC 64 OO 40S ribosomal protein S14 9986
99 6MTD 66 OO uS11 9986
100 6MTE 65 OO uS11 9986
101 6HCQ 19 P2 uS11 9986
102 6HCJ 19 P2 uS11 9986
103 6HCM 16 P1 uS11 9986
104 6HCF 16 P1 uS11 9986
105 6GZ3 31 BO ribosomal protein uS11 9986
106 6GZ4 34 BO ribosomal protein uS11 9986
107 6GZ5 31 BO ribosomal protein uS11 9986
108 6GSM 18 O 40S ribosomal protein S14 28985
109 6GSN 38 O 40S ribosomal protein S14 28985
110 6GQV 62 AE 40S ribosomal protein S14-B 4932
111 6GQ1 62 AE 40S ribosomal protein S14-B 4932
112 6GQB 62 AE 40S ribosomal protein S14-B 4932
113 6D9J 64 PP uS11 9986
114 6D90 65 PP uS11 9986
115 6G5H 12 O 40S ribosomal protein S14 9606
116 6G5I 16 O 40S ribosomal protein S14 9606
117 6G4S 27 O 40S ribosomal protein S14 9606
118 6G4W 23 O 40S ribosomal protein S14 9606
119 6G51 13 O 40S ribosomal protein S14 9606
120 6G53 13 O 40S ribosomal protein S14 9606
121 6G18 23 O 40S ribosomal protein S14 9606
122 6FYX 18 O 40S ribosomal protein S14 28985
123 6FYY 18 O 40S ribosomal protein S14 28985
124 6FEC 38 j 40S ribosomal protein S14 9606
125 6FAI 25 O 40S ribosomal protein S14-A 4932
126 6EML 22 Z 40S ribosomal protein S14-A 4932
127 6EK0 75 SO 40S ribosomal protein S14 9606
128 6AZ1 15 O ribosomal protein S11 5661
129 5OQL 42 t 40S ribosomal protein S14-like protein 209285
130 5OPT 14 V 40S ribosomal protein S14, putative 5693
131 5WLC 40 NG rpS14_uS11 4932
132 5XYI 16 O Ribosomal protein S14 5722
133 5XXU 16 O Ribosomal protein uS11 5811
134 5OA3 19 O 40S ribosomal protein S14 9606
135 5WYJ 45 SP 40S ribosomal protein S14-A 4932
136 5WYK 41 SP 40S ribosomal protein S14-A 4932
137 5MC6 27 Z 40S ribosomal protein S14-A 4932
138 5M1J 22 O2 40S ribosomal protein S14-A 4932
139 5LZS 65 OO uS11 9986
140 5LZT 66 OO uS11 9986
141 5LZU 65 OO uS11 9986
142 5LZV 66 OO uS11 9986
143 5LZW 66 OO uS11 9986
144 5LZX 66 OO uS11 9986
145 5LZY 64 OO uS11 9986
146 5LZZ 66 OO uS11 9986
147 5T2A 63 AH uS11 5661
148 5T2C 80 AO 40S ribosomal protein S14 9606
149 5LL6 12 Z 40S ribosomal protein S14-A 4932
150 5LKS 74 SO 40S ribosomal protein S14 9606
151 5K0Y 32 j ribosomal protein uS11 9986
152 5JUO 64 LB uS11 (yeast S14) 4932
153 5JUP 64 LB uS11 (yeast S14) 4932
154 5JUS 64 LB uS11 (yeast S14) 4932
155 5JUT 64 LB uS11 (yeast S14) 4932
156 5JUU 64 LB uS11 (yeast S14) 4932
157 5JPQ 29 w uS11 209285
158 5IT7 62 O 40S ribosomal protein S14 28985
159 5IT9 15 O Ribosomal protein uS14 28985
160 5FLX 16 O 40S RIBOSOMAL PROTEIN S14 9986
161 3JAP 18 O uS11 28985
162 3JAQ 18 O uS11 28985
163 3JAM 16 O uS11 28985
164 3JAN 64 SO Ribosomal protein uS11 SEE REMARK 999 9986
165 3JAJ 65 SO Ribosomal protein uS11 SEE REMARK 999 9986
166 3JAG 66 OO uS11 9986
167 3JAH 66 OO uS11 9986
168 3JAI 66 OO uS11 9986
170 4UG0 76 SO 40S RIBOSOMAL PROTEIN S14 9606
171 5AJ0 64 BO 40S ribosomal protein S14 9606
172 4UER 21 K US11 4934
173 4D61 16 O 40S RIBOSOMAL PROTEIN S14 9986
174 4D5L 16 O 40S RIBOSOMAL PROTEIN US11 9986
175 3J81 16 O uS11 28985
176 3J80 12 O uS11 28985
177 3J7P 64 SO Ribosomal protein uS11 9823
178 3J7R 65 SO Ribosomal protein uS11 9823
181 3J7A 16 P 40S ribosomal protein uS11 5833
182 3J77 60 14 40S ribosomal protein S14 4932
183 3J78 60 14 40S ribosomal protein S14 4932
184 3J6X 61 14 40S ribosomal protein S14 4932
185 3J6Y 61 14 40S ribosomal protein S14 4932
187 4V92 17 BO US11 28985
188 4V7E 16 BO 40S ribosomal protein S11 4565
189 4V8Y 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
190 4V8Z 23 AO 40S RIBOSOMAL PROTEIN S14-A 4932
191 4V6W 5 AO 40S ribosomal protein S14 7227
192 4V6X 5 AO 40S ribosomal protein S14 9606
193 4V8M 16 AH 40S RIBOSOMAL PROTEIN S14 185431
194 3J0O 12 K Ribosomal protein S14 9986
195 3J0L 12 K Ribosomal protein S14 9986
196 4V6I 12 AK 40S ribosomal protein rpS14 (S11p) 4932
197 4V7H 10 AK 40S ribosomal protein S14(A) 5541
198 4V5Z 18 Ak 40S Ribosomal protein S14e 9612
199 4V4B 11 AK 40S ribosomal protein S14-A 4932