5VYC

Crystal structure of the human 40S ribosomal subunit in complex with DENR-MCT-1.


Sequence Similarity Clusters for the Entities in PDB 5VYC

Entity #1 | Chains: T1,T2,T3,T4,T5,T6
40S ribosomal protein S19 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 43 1084
95 % 1 85 693
90 % 1 85 724
70 % 1 85 757
50 % 1 87 768
40 % 1 87 798
30 % 3 90 775
Entity #10 | Chains: C1,C2,C3,C4,C5,C6
40S ribosomal protein S2 protein, length: 293 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 27 1823
95 % 1 40 1577
90 % 1 52 1240
70 % 1 53 1258
50 % 1 56 1235
40 % 1 56 1261
30 % 1 56 1302
Entity #11 | Chains: G1,G2,G3,G4,G5,G6
40S ribosomal protein S6 protein, length: 249 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 529
95 % 1 85 698
90 % 1 85 729
70 % 1 91 702
50 % 39 182 294
40 % 39 187 294
30 % 39 187 311
Entity #12 | Chains: J1,J2,J3,J4,J5,J6
40S ribosomal protein S9 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 521
95 % 1 85 687
90 % 1 85 715
70 % 39 185 251
50 % 41 200 237
40 % 41 208 236
30 % 41 208 249
Entity #13 | Chains: M1,M2,M3,M4,M5,M6
40S ribosomal protein S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 64 712
95 % 1 77 768
90 % 1 77 806
70 % 1 82 783
50 % 1 83 808
40 % 1 83 838
30 % 1 83 882
Entity #14 | Chains: N1,N2,N3,N4,N5,N6
40S ribosomal protein S13 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 513
95 % 1 85 685
90 % 1 85 714
70 % 39 190 248
50 % 41 197 246
40 % 41 205 240
30 % 41 206 251
Entity #15 | Chains: O1,O2,O3,O4,O5,O6
40S ribosomal protein S14 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 73 612
95 % 1 73 820
90 % 1 81 773
70 % 41 198 231
50 % 41 199 238
40 % 41 199 250
30 % 41 199 262
Entity #16 | Chains: W1,W2,W3,W4,W5,W6
40S ribosomal protein S15a protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 509
95 % 1 86 677
90 % 1 86 706
70 % 42 203 225
50 % 42 204 230
40 % 43 214 230
30 % 391 808 22
Entity #17 | Chains: Y1,Y2,Y3,Y4,Y5,Y6
40S ribosomal protein S24 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 576
95 % 1 85 690
90 % 1 85 717
70 % 1 86 737
50 % 38 192 266
40 % 38 192 280
30 % 38 192 293
Entity #18 | Chains: Z1,Z2,Z3,Z4,Z5,Z6
40S ribosomal protein S25 protein, length: 125 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 57 810
95 % 1 57 1098
90 % 1 57 1137
70 % 1 58 1150
50 % 1 58 1208
40 % 1 59 1214
30 % 1 59 1256
Entity #19 | Chains: b1,b2,b3,b4,b5,b6
40S ribosomal protein S27 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 520
95 % 1 85 683
90 % 1 85 713
70 % 38 175 271
50 % 40 187 269
40 % 40 187 285
30 % 40 187 298
Entity #2 | Chains: U1,U2,U3,U4,U5,U6
40S ribosomal protein S20 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 887
95 % 1 56 1105
90 % 1 56 1149
70 % 1 57 1172
50 % 1 59 1164
40 % 1 59 1195
30 % 1 59 1237
Entity #20 | Chains: e1,e2,e3,e4,e5,e6
40S ribosomal protein S30 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 13142
95 % 1 31 1949
90 % 1 31 2011
70 % 1 31 2072
50 % 1 32 2082
40 % 1 32 2111
30 % 1 32 2144
Entity #21 | Chains: i1,i2,i3,i4,i5,i6
Human 18S ribosomal RNA rna, length: 1869 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: A1,A2,A3,A4,A5,A6
40S ribosomal protein SA protein, length: 295 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1880
95 % 1 54 1167
90 % 1 54 1206
70 % 1 54 1240
50 % 1 54 1283
40 % 1 54 1314
30 % 1 54 1353
Entity #23 | Chains: B1,B2,B3,B4,B5,B6
40S ribosomal protein S3a protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 925
95 % 1 58 1078
90 % 1 58 1119
70 % 1 58 1151
50 % 1 60 1156
40 % 40 161 340
30 % 40 161 361
Entity #24 | Chains: D1,D2,D3,D4,D5,D6
40S ribosomal protein S3 protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 41 1143
95 % 1 73 821
90 % 1 73 853
70 % 1 74 877
50 % 40 168 321
40 % 40 168 336
30 % 40 168 353
Entity #25 | Chains: E1,E2,E3,E4,E5,E6
40S ribosomal protein S4, X isoform protein, length: 263 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 883
95 % 1 73 812
90 % 1 85 712
70 % 38 181 261
50 % 40 191 255
40 % 40 191 267
30 % 40 199 267
Entity #26 | Chains: F1,F2,F3,F4,F5,F6
40S ribosomal protein S5 protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 505
95 % 1 86 679
90 % 1 86 707
70 % 1 101 624
50 % 41 201 235
40 % 41 201 246
30 % 41 201 260
Entity #27 | Chains: H1,H2,H3,H4,H5,H6
40S ribosomal protein S7 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 530
95 % 1 85 696
90 % 1 85 727
70 % 1 86 740
50 % 38 188 273
40 % 38 188 288
30 % 40 191 283
Entity #28 | Chains: I1,I2,I3,I4,I5,I6
40S ribosomal protein S8 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 577
95 % 1 85 702
90 % 1 85 736
70 % 1 85 756
50 % 40 190 259
40 % 40 194 262
30 % 40 194 275
Entity #29 | Chains: K1,K2,K3,K4,K5,K6
40S ribosomal protein S10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 919
95 % 1 53 1192
90 % 1 53 1215
70 % 1 53 1269
50 % 1 54 1273
40 % 1 55 1305
30 % 1 55 1339
Entity #3 | Chains: V1,V2,V3,V4,V5,V6
40S ribosomal protein S21 protein, length: 83 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 65 704
95 % 1 84 704
90 % 1 84 743
70 % 1 85 747
50 % 38 176 306
40 % 38 176 320
30 % 38 176 337
Entity #30 | Chains: L1,L2,L3,L4,L5,L6
40S ribosomal protein S11 protein, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 508
95 % 1 86 676
90 % 1 86 705
70 % 1 87 733
50 % 41 197 245
40 % 41 197 256
30 % 41 197 268
Entity #31 | Chains: P1,P2,P3,P4,P5,P6
40S ribosomal protein S15 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 31 1561
95 % 1 84 709
90 % 1 84 745
70 % 1 86 745
50 % 40 179 299
40 % 40 186 292
30 % 40 187 306
Entity #32 | Chains: Q1,Q2,Q3,Q4,Q5,Q6
40S ribosomal protein S16 protein, length: 146 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 76 587
95 % 1 76 784
90 % 1 76 826
70 % 1 79 818
50 % 41 190 253
40 % 41 198 255
30 % 41 199 263
Entity #33 | Chains: R1,R2,R3,R4,R5,R6
40S ribosomal protein S17 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 29 1663
95 % 1 85 691
90 % 1 85 718
70 % 1 86 738
50 % 40 176 301
40 % 40 176 313
30 % 40 176 332
Entity #34 | Chains: S1,S2,S3,S4,S5,S6
40S ribosomal protein S18 protein, length: 152 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 506
95 % 1 86 680
90 % 1 86 708
70 % 39 183 254
50 % 41 192 251
40 % 41 202 243
30 % 41 202 257
Entity #35 | Chains: j1,j2,j3,j4,j5,j6
60S ribosomal protein L41 protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 557
95 % 1 82 722
90 % 1 82 761
70 % 38 163 284
50 % 38 163 331
40 % 38 163 348
30 % 38 163 365
Entity #36 | Chains: k1,k2,k3,k4,k5,k6
Malignant T-cell-amplified sequence 1 protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 12031
95 % 4 4 4080
90 % 4 4 4242
70 % 4 4 4116
50 % 4 4 4153
40 % 4 4 3997
30 % 4 4 4007
Entity #37 | Chains: l1,l2,l3,l4,l5,l6
Density-regulated protein protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 5443
95 % 3 3 6028
90 % 3 3 6227
70 % 3 3 6115
50 % 3 3 5869
40 % 3 3 5589
30 % 3 3 5343
Entity #4 | Chains: X1,X2,X3,X4,X5,X6
40S ribosomal protein S23 protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 526
95 % 1 88 660
90 % 1 89 687
70 % 41 204 222
50 % 41 214 220
40 % 41 214 231
30 % 41 214 240
Entity #5 | Chains: a1,a2,a3,a4,a5,a6
40S ribosomal protein S26 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 35 1336
95 % 1 49 1281
90 % 1 49 1318
70 % 1 50 1322
50 % 3 81 779
40 % 5 83 757
30 % 5 83 792
Entity #6 | Chains: c1,c2,c3,c4,c5,c6
40S ribosomal protein S28 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 67 676
95 % 1 67 918
90 % 1 67 961
70 % 39 191 247
50 % 41 202 232
40 % 41 203 242
30 % 41 203 254
Entity #7 | Chains: d1,d2,d3,d4,d5,d6
40S ribosomal protein S29 protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 560
95 % 1 83 711
90 % 1 83 747
70 % 39 169 280
50 % 39 177 302
40 % 39 177 314
30 % 39 177 333
Entity #8 | Chains: f1,f2,f3,f4,f5,f6
Ribosomal protein S27a protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 11798
95 % 1 50 1265
90 % 1 50 1297
70 % 4 82 729
50 % 6 86 728
40 % 6 89 734
30 % 6 89 768
Entity #9 | Chains: g1,g2,g3,g4,g5,g6
Receptor of activated protein C kinase 1 protein, length: 317 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 85 500
95 % 2 85 669
90 % 2 85 700
70 % 3 87 713
50 % 46 176 281
40 % 48 182 274
30 % 48 183 285

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1SEI 1 A, B RIBOSOMAL PROTEIN S8 1422
2 4YBB 8 AH, BH 30S ribosomal protein S8 562
3 4Y4O 39 1h, 2h 30S ribosomal protein S8 274
4 5J8B 41 h 30S ribosomal protein S8 274
5 1AN7 1 A, B RIBOSOMAL PROTEIN S8 274
6 4W2F 8 AH, CH 30S Ribosomal Protein S8 274
7 6CFL 39 1h, 2h 30S Ribosomal Protein S8 274
8 6CAE 39 1h, 2h 30S ribosomal protein S8 274
9 4Y4P 39 1h, 2h 30S ribosomal protein S8 274
10 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
11 5FDV 40 1h, 2h 30S ribosomal protein S8 274
12 5J4B 39 1h, 2h 30S ribosomal protein S8 274
13 4W2G 8 AH, CH 30S Ribosomal Protein S8 274
14 6CFK 39 1h, 2h 30S ribosomal protein S8 274
15 5J7L 8 AH, BH 30S ribosomal protein S8 562
16 5W4K 39 1h, 2h 30S ribosomal protein S8 274
17 4LFB 8 H ribosomal protein S8 274
18 1VY4 8 AH, CH 30S ribosomal protein S8 274
19 4WOI 8 AH, DH 30S ribosomal protein S8 562
20 5FDU 39 1h, 2h 30S ribosomal protein S8 274
21 6I7V 12 AH, BH 30S ribosomal protein S8 562
22 4W2I 8 AH, CH 30S Ribosomal Protein S8 274
23 5JC9 8 AH, BH 30S ribosomal protein S8 562
24 1VY5 8 AH, CH 30S ribosomal protein S8 274
25 5HCQ 39 1h, 2h 30S ribosomal protein S8 274
26 4WQF 41 BH, DH 30S ribosomal protein S8 274
27 6ND5 39 1h, 2h 30S ribosomal protein S8 274
28 4W2H 8 AH, CH 30S Ribosomal Protein S8 274
29 4WPO 41 BH, DH 30S ribosomal protein S8 274
30 5J8A 8 AH, BH 30S ribosomal protein S8 562
31 4V8I 8 AH, CH 30S Ribosomal Protein S8 274
32 4JI1 8 H RIBOSOMAL PROTEIN S8 274
33 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
34 4Z3S 39 1h, 2h 30S ribosomal protein S8 274
35 5DOY 39 1h, 2h 30S Ribosomal Protein S8 274
36 5J5B 8 AH, BH 30S ribosomal protein S8 562
37 5HD1 39 1h, 2h 30S ribosomal protein S8 274
38 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
39 4DR6 8 H 30S ribosomal protein S8 274
40 4LF7 8 H ribosomal protein S8 274
41 4LF8 8 H ribosomal protein S8 274
42 5WIS 39 1h, 2h 30S ribosomal protein S8 274
43 4WSD 8 72, 7E 30S ribosomal protein S8 274
44 4WQU 41 BH, DH 30S ribosomal protein S8 274
45 5WIT 39 1h, 2h 30S ribosomal protein S8 274
46 5E81 8 72, 7E 30S ribosomal protein S8 274
47 2VQE 8 H 30S RIBOSOMAL PROTEIN S8 274
48 6GSJ 8 72, 7E 30S ribosomal protein S8 274
49 4U27 8 AH, CH 30S ribosomal protein S8 562
50 6OF1 39 1h, 2h 30S ribosomal protein S8 274
51 6CFJ 39 1h, 2h 30S ribosomal protein S8 274
52 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
53 4Z8C 39 1h, 2h 30S ribosomal protein S8 274
54 5HCR 39 1h, 2h 30S ribosomal protein S8 274
55 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
56 2UUB 8 H 30S RIBOSOMAL PROTEIN S8 274
57 4DV6 8 H ribosomal protein S8 274
58 4JYA 8 H 30S ribosomal protein S8 274
59 5IBB 8 72, 7E 30S ribosomal protein S8 274
60 4DR5 8 H 30S ribosomal protein S8 274
61 5J4C 39 1h, 2h 30S ribosomal protein S8 274
62 4KHP 8 H 30S Ribosomal protein S8 274
63 4DR2 8 H 30S ribosomal protein S8 274
64 4WRO 12 7E 30S ribosomal protein S8 274
65 4WQ1 8 72, 7E 30S ribosomal protein S8 274
66 4LF9 8 H ribosomal protein S8 274
67 4WQY 41 BH, DH 30S ribosomal protein S8 274
68 4DUY 8 H ribosomal protein S8 274
69 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
70 4DV7 8 H ribosomal protein S8 274
71 4WRA 8 72, 7E 30S ribosomal protein S8 274
72 1S03 2 G, H 30S ribosomal protein S8 562
73 5IB7 8 72, 7E 30S ribosomal protein S8 274
74 4U26 8 AH, CH 30S ribosomal protein S8 562
75 4X64 8 H 30S ribosomal protein S8 274
76 5HCP 39 1h, 2h 30S ribosomal protein S8 274
77 5IT8 8 AH, BH 30S ribosomal protein S8 562
78 4V9D 8 AH, BH 30S ribosomal protein S8 562
79 4V9P 40 BH, DH, FH, HH 30S ribosomal protein S8 562
80 4V9H 21 AH 30S ribosomal protein S8 274
81 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
82 5J91 8 AH, BH 30S ribosomal protein S8 562
83 4V8D 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
84 5WNT 8 H RIBOSOMAL PROTEIN S8 274
85 4DR3 8 H 30S ribosomal protein S8 274
86 4V90 8 AH 30S RIBOSOMAL PROTEIN S8 274
87 4JI3 8 H RIBOSOMAL PROTEIN S8 274
88 4WQR 8 72, 7E 30S ribosomal protein S8 274
89 4JI6 8 H RIBOSOMAL PROTEIN S8 274
90 4JI8 8 H RIBOSOMAL PROTEIN S8 274
91 2UXC 8 H RIBOSOMAL PROTEIN S8 274
92 5IB8 8 72, 7E 30S ribosomal protein S8 274
93 4V9R 8 AH, CH 30S Ribosomal Protein S8 274
94 4B3M 8 H 30S RIBOSOMAL PROTEIN S8 274
95 5EL6 8 72, 7E 30S ribosomal protein S8 274
96 6O97 39 1h, 2h 30S ribosomal protein S8 274
97 5EL7 8 72, 7E 30S ribosomal protein S8 274
98 5VP2 39 1h, 2h 30S ribosomal protein S8 274
99 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
100 4LF4 8 H ribosomal protein S8 274
101 5DFE 42 QH, XH 30S ribosomal protein S8 274
102 5NDK 50 72, 7E 30S ribosomal protein S8 274
103 4LF6 8 H ribosomal protein S8 274
104 4JI7 8 H RIBOSOMAL PROTEIN S8 274
105 5J88 8 AH, BH 30S ribosomal protein S8 562
106 4U24 8 AH, CH 30S ribosomal protein S8 562
107 4WU1 8 72, 7E 30S ribosomal protein S8 274
108 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
109 6QNR 8 72, 7E 30S ribosomal protein S8 274
110 5EL4 8 72, 7E 30S ribosomal protein S8 274
111 5WNV 8 H 30S ribosomal protein S8 274
112 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
113 4B3T 8 H 30S RIBOSOMAL PROTEIN S8 274
114 4WR6 8 72, 7E 30S ribosomal protein S8 274
115 4V8B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
116 5HAU 41 1h, 2h 30S ribosomal protein S8 274
117 4V9O 41 BH, DH, FH, HH 30S ribosomal protein S8 562
118 6MPF 8 H 30S ribosomal protein S8 274
119 2VQF 8 H 30S RIBOSOMAL PROTEIN S8 274
120 2UUA 8 H 30S RIBOSOMAL PROTEIN S8 274
121 4V87 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
122 4WF1 8 AH, CH 30S ribosomal protein S8 562
123 4U25 8 AH, CH 30S ribosomal protein S8 562
124 4V95 8 AH, CH 30S Ribosomal Protein S8 274
125 4WWW 39 QH, XH 30S ribosomal protein S8 562
126 4V7T 8 AH, CH 30S ribosomal protein S8 562
127 1VY7 8 AH, CH 30S ribosomal protein S8 274
128 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
129 5E7K 8 72, 7E 30S ribosomal protein S8 274
130 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
131 5EL5 8 72, 7E 30S ribosomal protein S8 274
132 6FKR 39 1h, 2h 30S ribosomal protein S8 274
133 4B3R 8 H 30S RIBOSOMAL PROTEIN S8 274
134 4LNT 8 QH, XH 30S ribosomal protein S8 274
135 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
136 4DR1 8 H 30S ribosomal protein S8 274
137 4LFA 8 H ribosomal protein S8 274
138 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
139 4DV4 8 H ribosomal protein S8 274
140 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
141 4YZV 8 QH, XH 30S ribosomal protein S8 274
142 4JI0 8 H ribosomal protein S8 274
143 5IWA 7 H 30S ribosomal protein S8 274
144 4V7U 8 AH, CH 30S ribosomal protein S8 562
145 4V9S 8 AH, CH 30S Ribosomal Protein S8 274
146 4JI2 8 H RIBOSOMAL PROTEIN S8 274
147 4V6C 7 AH, CH 30S ribosomal protein S8 562
148 4JV5 8 H 30S ribosomal protein S8 274
149 4DR7 8 H 30S ribosomal protein S8 274
150 1J5E 8 H 30S RIBOSOMAL PROTEIN S8 274
151 6OF6 8 QH, XH 30S ribosomal protein S8 274
152 4GKK 8 H 30S ribosomal protein S8 274
153 4DUZ 8 H ribosomal protein S8 274
154 5NDJ 50 72, 7E 30S ribosomal protein S8 274
155 4V7V 8 AH, CH 30S ribosomal protein S8 562
156 4X65 8 H 30S ribosomal protein S8 274
157 4V8G 8 AH, CH 30S Ribosomal Protein S8 274
158 4GKJ 8 H 30S ribosomal protein S8 274
159 4DV3 8 H ribosomal protein S8 274
160 4V7S 8 AH, CH 30S ribosomal protein S8 562
161 4DV5 8 H ribosomal protein S8 274
162 5DAT 24 D2 40S ribosomal protein S22-A 4932
163 5DAT 80 d2 40S ribosomal protein S22-A 4932
164 6LKQ 7 G 30S ribosomal protein S8 562
165 2UUC 8 H 30S RIBOSOMAL PROTEIN S8 274
166 4LFC 8 H ribosomal protein S8 274
167 1FJG 9 H 30S RIBOSOMAL PROTEIN S8 274
168 3T1Y 8 H 30S ribosomal protein S8 274
169 4WZO 8 72, 7E 30S ribosomal protein S8 274
170 4JI4 8 H RIBOSOMAL PROTEIN S8 274
171 1VY6 8 AH, CH 30S ribosomal protein S8 274
172 1XMQ 10 H 30S Ribosomal Protein S8 274
173 5WNP 8 H 30S ribosomal protein S8 274
174 6CAP 8 H 30S ribosomal protein S8 274
175 4U20 8 AH, CH 30S ribosomal protein S8 562
176 6MPI 8 H 30S ribosomal protein S8 274
177 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
178 4DV0 8 H ribosomal protein S8 274
179 4V9B 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
180 4U1V 8 AH, CH 30S ribosomal protein S8 562
181 4V6F 38 BK, CK 30S ribosomal protein S8 274
182 4X62 8 H 30S ribosomal protein S8 274
183 4V8F 38 BK, CK 30S RIBOSOMAL PROTEIN S8 274
184 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
185 4B3S 8 H 30S RIBOSOMAL PROTEIN S8 274
186 4DV2 8 H ribosomal protein S8 274
187 4DV1 8 H ribosomal protein S8 274
188 5WNU 8 H 30S ribosomal protein S8 274
189 1N32 10 H 30S RIBOSOMAL PROTEIN S8 274
190 5F8K 39 1h, 2h 30S ribosomal protein S8 274
191 1I94 8 H 30S RIBOSOMAL PROTEIN S8 274
192 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
193 4V8H 8 AH, CH 30S Ribosomal Protein S8 274
194 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
195 4JI5 8 H RIBOSOMAL PROTEIN S8 274
196 6CAQ 8 H 30S ribosomal protein S8 274
197 4K0K 8 H 30S ribosomal protein S8 274
198 4W2E 41 h 30S ribosomal protein S8 274
199 4V8C 38 CK, DK 30S RIBOSOMAL PROTEIN S8 274
200 5BR8 8 H 30S ribosomal protein S8 274
201 4LF5 8 H ribosomal protein S8 274
202 5J4D 42 QA, VC 30S ribosomal protein S8 274
203 4V9A 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
204 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
205 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
206 4V5J 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
207 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
208 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
209 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
210 6ND6 39 1h, 2h 30S ribosomal protein S8 274
211 4V7Y 8 AH, CH 30S ribosomal protein S8 274
212 6UO1 39 1h, 2h 30S ribosomal protein S8 274
213 6GSK 8 72, 7E 30S ribosomal protein S8 274
214 4V9C 8 AH, CH 30S ribosomal protein S8 562
215 4V8E 38 BK, DK 30S RIBOSOMAL PROTEIN S8 274
216 5J30 39 QH, XH 30S ribosomal protein S8 274
217 6QNQ 8 72, 7E 30S ribosomal protein S8 274
218 4DR4 8 H 30S ribosomal protein S8 274
219 4WZD 8 72, 7E 30S ribosomal protein S8 274
220 6OPE 8 QH, XH 30S ribosomal protein S8 274
221 3OTO 8 H 30S RIBOSOMAL PROTEIN S8 274
222 4X66 8 H 30S ribosomal protein S8 274
223 2UU9 8 H 30S RIBOSOMAL PROTEIN S8 274
224 4V8Q 42 BH 30S RIBOSOMAL PROTEIN S8 274
225 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
226 4V85 8 AH 30S ribosomal protein S8 562
227 1HR0 9 H 30S RIBOSOMAL PROTEIN S8 274
228 4AQY 8 H 30S RIBOSOMAL PROTEIN S8 274
229 4W4G 8 QH, XH 30S ribosomal protein S8 274
230 4NXM 8 H ribosomal protein S8 274
231 4V5L 8 AH 30S RIBOSOMAL PROTEIN S8 274
232 4YPB 8 QH, XH 30S ribosomal protein S8 274
233 4V7X 8 AH, CH 30S ribosomal protein S8 274
234 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
235 4U1U 8 AH, CH 30S ribosomal protein S8 562
236 4ZER 39 1h, 2h 30S ribosomal protein S8 274
237 1IBL 11 H 30S RIBOSOMAL PROTEIN S8 274
238 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
239 6ORD 8 QH, XH 30S ribosomal protein S8 274
240 4V7W 8 AH, CH 30S ribosomal protein S8 274
241 4WT1 8 72, 7E 30S ribosomal protein S8 274
242 6C5L 8 AH, CH 30S ribosomal protein S8 274
243 4WT8 8 AH, BH 30S ribosomal protein S8 274
244 5DOX 39 1h, 2h 30S ribosomal protein S8 274
245 6OTR 8 QH, XH 30S ribosomal protein S8 274
246 4NXN 8 H ribosomal protein S8 274
247 1XNR 10 H 16S Ribosomal protein S8 274
248 4LT8 8 QH, XH 30S ribosomal protein S8 274
249 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
250 5WNQ 8 H 30S ribosomal protein S8 274
251 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
252 6MKN 8 H 30S ribosomal protein S8 274
253 4V51 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
254 6DTI 8 H 30S ribosomal protein S8 274
255 4V7L 8 AH, CH 30S ribosomal protein S8 274
256 4V5R 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
257 1HNZ 9 H 30S RIBOSOMAL PROTEIN S8 274
258 1XNQ 10 H Ribosomal protein S8 274
259 4V8A 38 CH, DH 30S ribosomal protein S8 274
260 4V5K 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
261 4V5Q 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
262 4V7J 7 Ah, Bh 30S ribosomal protein S8 274
263 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
264 6BZ6 8 QH, XH 30S ribosomal protein S8 274
265 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
266 5J3C 39 QH, XH 30S ribosomal protein S8 274
267 4V5C 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
268 4V5E 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
269 4L47 8 QH, XH 30S ribosomal protein S8 274
270 4V5P 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
271 5V8I 39 1h, 2h 30S ribosomal protein S8 274
272 4ZSN 8 QH, XH 30S ribosomal protein S8 274
273 4V5D 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
274 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
275 6CZR 39 1h, 2h 30S ribosomal protein S8 274
276 6OXA 8 QH, XH 30S ribosomal protein S8 274
277 6BUW 8 QH, XH 30S ribosomal protein S8 274
278 4V7Z 8 AH, CH 30S ribosomal protein S8 274
279 4V8X 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
280 4V5S 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
281 4V9I 8 AH, CH 30S Ribosomal protein S8 274
282 1XMO 10 H 30S ribosomal protein S8 274
283 3T1H 8 H 30S ribosomal protein S8 274
284 2UXD 8 H RIBOSOMAL PROTEIN S8 274
285 6OJ2 8 QH, XH 30S ribosomal protein S8 274
286 1N33 10 H 30S RIBOSOMAL PROTEIN S8 274
287 1IBK 9 H 30S RIBOSOMAL PROTEIN S8 274
288 4V6G 8 AK, CK 30S RIBOSOMAL PROTEIN S8 274
289 4V8N 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
290 4V97 8 AH, CH 30S ribosomal protein S8 274
291 6CAR 8 H 30S ribosomal protein S8 274
292 1HNW 9 H 30S RIBOSOMAL PROTEIN S8 274
293 4V7M 8 AH, CH 30S ribosomal protein S8 274
294 4WSM 8 72, 7E 30S ribosomal protein S8 274
295 4TUD 8 QH, XH 30S ribosomal protein S8 274
296 1IBM 11 H 30S RIBOSOMAL PROTEIN S8 274
297 5WNR 8 H 30S ribosomal protein S8 274
298 6CAO 8 H 30S ribosomal protein S8 274
299 4V6A 8 AH, CH 30S ribosomal protein S8 274
300 4TUE 8 QH, XH 30S ribosomal protein S8 274
301 6OXI 8 QH, XH 30S ribosomal protein S8 274
302 4TUA 8 QH, XH 30S ribosomal protein S8 274
303 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
304 4V84 8 AH, CH 30S ribosomal protein S8 274
305 5WNS 8 H 30S ribosomal protein S8 274
306 6NDK 8 QH, XH 30S ribosomal protein S8 274
307 4V7K 7 Ah, Bh 30S ribosomal protein S8 274
308 4YY3 8 H 30S ribosomal protein S8 274
309 1HNX 9 H 30S RIBOSOMAL PROTEIN S8 274
310 4V9Q 38 BH, DH 30S ribosomal protein S8 274
311 6BZ8 8 QH, XH 30S ribosomal protein S8 274
312 4TUC 8 QH, XH 30S ribosomal protein S8 274
313 4YHH 8 H 30S ribosomal protein S8 274
314 5VPO 9 QH, XH 30S ribosomal protein S8 274
315 6NY6 8 H 30S ribosomal protein S8 274
316 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
317 4TUB 8 QH, XH 30S ribosomal protein S8 274
318 4V9N 11 AH, CH 30S ribosomal protein S8 274
319 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
320 4P70 8 QH, XH 30S ribosomal protein S8 274
321 4V8U 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
322 4LSK 8 QH, XH 30S ribosomal protein S8 274
323 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
324 4V6D 7 AH, CH 30S ribosomal protein S8 562
325 4P6F 8 QH, XH 30S ribosomal protein S8 274
326 4V67 10 AH, CH 30S ribosomal protein S8 274
327 4V83 8 AH, CH 30S ribosomal protein S8 274
328 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
329 4V5F 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
330 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
331 1VVJ 8 QH, XH 30S ribosomal protein S8 274
332 4LFZ 8 QH, XH 30S ribosomal protein S8 274
333 2E5L 9 H 30S ribosomal protein S8 274
334 6BZ7 8 QH, XH 30S ribosomal protein S8 274
335 6N1D 42 AS08, BS08 30S ribosomal protein S8 274
336 4V6E 7 AH, CH 30S ribosomal protein S8 562
337 6UCQ 38 1h, 2h 30S ribosomal protein S8 274
338 6CAS 8 H 30S ribosomal protein S8 274
339 4V52 7 AH, CH 30S ribosomal protein S8 562
340 5CZP 39 QH, XH 30S ribosomal protein S8 274
341 6N9F 39 1h, 2h 30S Ribosomal Protein S8 274
342 6N9E 39 1h, 2h 30S Ribosomal Protein S8 274
343 2HHH 8 H 30S ribosomal protein S8 274
344 4V89 8 AH 30S ribosomal protein S8 562
345 4OX9 8 H 30S ribosomal protein S8 274
346 4V54 7 AH, CH 30S ribosomal protein S8 562
347 2UXB 8 H RIBOSOMAL PROTEIN S8 274
348 1I96 8 H 30S RIBOSOMAL PROTEIN S8 274
349 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
350 4V9K 7 AH, CH 30S ribosomal protein S8 274
351 4V50 10 AH, CH 30S ribosomal protein S8 562
352 1N34 9 H 30S RIBOSOMAL PROTEIN S8 274
353 4V57 7 AH, CH 30S ribosomal protein S8 562
354 4V5A 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
355 4V63 10 AH, CH 30S ribosomal protein S8 274
356 4L71 8 QH, XH 30S ribosomal protein S8 274
357 4KVB 8 H 30S ribosomal protein S8 274
358 4XEJ 35 AS08, BS08 30S ribosomal protein S8 274
359 4V64 7 AH, CH 30S ribosomal protein S8 562
360 4V7P 8 AH, DH 30S ribosomal protein S8 274
361 4V8J 8 AH, CH 30S ribosomal protein S8 274
362 1N36 8 H 30S RIBOSOMAL PROTEIN S8 274
363 2ZM6 8 H 30S ribosomal protein S8 274
364 4V4H 7 AH, CH 30S RIBOSOMAL PROTEIN S8 562
365 4V4Q 7 AH, CH 30S ribosomal protein S8 562
366 4V5B 40 BH, DH 30S RIBOSOMAL PROTEIN S8 RESIDUES 2-130 562
367 5D8B 35 EC, IA 30S ribosomal protein S8 274
368 6BY1 43 AH, BH 30S ribosomal protein S8 562
369 4LEL 8 QH, XH 30S ribosomal protein S8 274
370 4V53 7 AH, CH 30S ribosomal protein S8 562
371 2F4V 9 H 30S ribosomal protein S8 274
372 4V9L 7 AH, CH 30S ribosomal protein S8 274
373 1FKA 8 H 30S RIBOSOMAL PROTEIN S8 274
374 4V5G 8 AH, CH 30S RIBOSOMAL PROTEIN S8 274
375 4V56 7 AH, CH 30S ribosomal protein S8 562
376 1I97 8 H 30S RIBOSOMAL PROTEIN S8 274
377 4V9J 7 AH, CH 30S ribosomal protein S8 274
378 4V55 7 AH, CH 30S ribosomal protein S8 562
379 1I95 8 H 30S RIBOSOMAL PROTEIN S8 274
380 4V8O 8 AH 30S RIBOSOMAL PROTEIN S8 274
381 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
382 4V9M 7 AH, CH 30S ribosomal protein S8 274
383 4W29 7 AH, CH 30S ribosomal protein S8 274
384 4V5Y 7 AH, CH 30S ribosomal protein S8 562
385 4V4Y 10 AK 30S ribosomal protein S8 274
386 4V4J 41 i 30S ribosomal protein S8 274
387 4V4X 10 AK 30S ribosomal protein S8 274
388 4V4Z 11 AK 30S ribosomal protein S8 274
389 4V4I 41 i 30S ribosomal protein S8 274
390 4V4P 43 BK 30S ribosomal protein S8 274
391 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
392 4V4R 11 AH 30S ribosomal protein S8 274
393 4V4S 11 AH 30S ribosomal protein S8 274
394 4V4T 11 AH 30S ribosomal protein S8 274
395 4KZZ 23 W 40S Ribosomal Protein S15A 9986
396 4KZX 23 W 40S ribosomal protein S15A 9986
397 4KZY 23 W 40S Ribosomal Protein S15A 9986
398 4V49 10 AH 30S ribosomal protein S8 562
399 4V4A 8 AH 30S ribosomal protein S8 562
400 4V4G 8 AH, CH, EH, GH, IH 30S ribosomal protein S8 562
401 6WNV 36 M 30S ribosomal protein S8 562
402 6WNW 38 M 30S ribosomal protein S8 562
403 6WD0 37 M 30S ribosomal protein S8 562
404 6WD1 37 M 30S ribosomal protein S8 562
405 6WD2 37 M 30S ribosomal protein S8 562
406 6WD3 37 M 30S ribosomal protein S8 562
407 6WD4 37 M 30S ribosomal protein S8 562
408 6WD5 37 M 30S ribosomal protein S8 562
409 6WD6 37 M 30S ribosomal protein S8 562
410 6WD7 37 M 30S ribosomal protein S8 562
411 6WD8 37 M 30S ribosomal protein S8 562
412 6WD9 37 M 30S ribosomal protein S8 562
413 6WDA 37 M 30S ribosomal protein S8 562
414 6WDB 37 M 30S ribosomal protein S8 562
415 6WDC 37 M 30S ribosomal protein S8 562
416 6WDD 37 M 30S ribosomal protein S8 562
417 6WDE 37 M 30S ribosomal protein S8 562
418 6WDF 37 M 30S ribosomal protein S8 562
419 6WDG 37 M 30S ribosomal protein S8 562
420 6WDH 37 M 30S ribosomal protein S8 562
421 6WDI 37 M 30S ribosomal protein S8 562
422 6WDJ 37 M 30S ribosomal protein S8 562
423 6WDK 37 M 30S ribosomal protein S8 562
424 6WDL 37 M 30S ribosomal protein S8 562
425 6WDM 37 M 30S ribosomal protein S8 562
426 6YAL 23 Y 40S ribosomal protein uS8 9986
427 6YAM 23 Y 40S ribosomal protein uS8 9986
428 6YAN 22 Y Ribosomal protein S15a 9986
429 6W2S 15 X uS8 9986
430 6W2T 14 X uS8 9986
431 6Y7C 22 W 40S ribosomal protein S22-A 4932
432 6Y69 8 h 30S ribosomal protein S8 562
433 6Y57 71 SW 40S ribosomal protein S15a 9606
434 6VWL 38 g 30S ribosomal protein S8 562
435 6VWM 38 g 30S ribosomal protein S8 562
436 6VWN 38 g 30S ribosomal protein S8 562
437 6Y2L 71 SW 40S ribosomal protein S15a 9606
438 6Y0G 72 SW 40S ribosomal protein S15a 9606
439 6XYW 64 Bg 40S ribosomal protein S15a-5 3702
440 6TNU 26 b 40S ribosomal protein S22-A 4932
441 6TMF 10 J 30S ribosomal protein S8 2264
442 6V39 38 h 30S ribosomal protein S8 470
443 6V3A 38 h 30S ribosomal protein S8 470
444 6V3B 38 h 30S ribosomal protein S8 470
445 6V3E 8 h 30S ribosomal protein S8 470
446 6UZ7 70 W 40S ribosomal protein S22 28985
447 6TC3 8 S081 30S ribosomal protein S8 562
448 6TBV 8 S081 30S ribosomal protein S8 562
449 6TB3 26 b 40S ribosomal protein S22-A 4932
450 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
451 6T7T 26 SW 40S ribosomal protein S22-A 4932
452 6T7I 24 SW 40S ribosomal protein S22-A 4932
453 6T4Q 23 SW 40S ribosomal protein S22-A 4932
454 6SZS 39 h 30S ribosomal protein S8 562
455 6SW9 10 I 30S ribosomal protein S8 29292
456 6SWC 10 I 30S ribosomal protein S8 29292
457 6SWD 9 I 30S ribosomal protein S8 29292
458 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
459 6SPC 8 h 30S ribosomal protein S8 287
460 6SPE 8 h 30S ribosomal protein S8 287
461 6SPF 40 h 30S ribosomal protein S8 287
462 6SPG 8 h 30S ribosomal protein S8 287
463 6SNT 24 W 40S ribosomal protein S22-A 4932
464 6SGC 24 X1 Ribosomal protein S15a 9986
465 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
466 6S0X 38 h 30S ribosomal protein S8 1280
467 6S13 38 h 30S ribosomal protein S8 1280
468 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
469 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
470 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
471 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
472 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
473 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
474 6P5I 24 X uS8 9986
475 6P5J 24 X uS8 9986
476 6P5K 70 X uS8 9986
477 6P5N 70 X uS8 9986
478 6P4G 24 X uS8 9986
479 6P4H 25 X uS8 9986
480 6OUO 40 m 30S ribosomal protein S8 562
481 6RM3 69 SW0 uS8 6039
482 6OSQ 41 m 30S ribosomal protein S8 562
483 6OST 38 m 30S ribosomal protein S8 562
484 6OT3 40 m 30S ribosomal protein S8 562
485 6OSK 40 m 30S ribosomal protein S8 562
486 6ORE 42 m 30S ribosomal protein S8 562
487 6ORL 38 m 30S ribosomal protein S8 562
488 6OM7 29 SW 40S ribosomal protein S15a 9606
489 6OLZ 69 BW 40S ribosomal protein S15a 9606
490 6OM0 29 SW 40S ribosomal protein S15a 9606
491 6OLE 29 SW 40S ribosomal protein S15a 9606
492 6OLF 29 SW 40S ribosomal protein S15a 9606
493 6OLG 72 BW 40S ribosomal protein S15a 9606
494 6OLI 29 SW 40S ribosomal protein S15a 9606
495 6OKK 11 K 40S ribosomal protein S15A 5833
496 6RBD 15 W 40S ribosomal protein S22-A 4932
497 6RBE 15 W 40S ribosomal protein S22-A 4932
498 6OGF 35 M 30S ribosomal protein S8 562
499 6OGG 35 M 30S ribosomal protein S8 562
500 6OGI 35 M 30S ribosomal protein S8 562
501 6OFX 35 M 30S ribosomal protein S8 562
502 6OG7 35 M 30S ribosomal protein S8 562
503 6R7Q 82 TT Ribosomal protein S15a 9986
504 6R6G 50 TT Ribosomal protein S15a 9986
505 6R6P 66 TT Ribosomal protein S15a 9986
506 6R5Q 74 TT Ribosomal protein S15a 9986
507 6O9J 38 h 30S ribosomal protein S8 562
508 6O9K 8 h 30S ribosomal protein S8 562
509 6QZP 76 SW 40S ribosomal protein S15a 9606
510 6O7K 22 p 30S ribosomal protein S8 562
511 6NQB 9 H 30S ribosomal protein S8 562
512 6Q95 8 m 30S ribosomal protein S8 274
513 6Q97 45 m 30S ribosomal protein S8 562
514 6Q98 43 m 30S ribosomal protein S8 562
515 6Q9A 43 m 30S ribosomal protein S8 562
516 6Q8Y 27 b 40S ribosomal protein S22-A 4932
517 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
518 6IP5 75 3M 40S ribosomal protein S15a 9606
519 6IP6 74 3M 40S ribosomal protein S15a 9606
520 6IP8 74 3M 40S ribosomal protein S15a 9606
521 6MTB 73 WW 40S ribosomal protein S15a 9986
522 6MTC 72 WW 40S ribosomal protein S15a 9986
523 6MTD 74 WW uS8 9986
524 6MTE 73 WW uS8 9986
525 6HTQ 37 h 30S ribosomal protein S8 1423
526 6HRM 40 m 30S ribosomal protein S8 562
527 6HCQ 27 X2 Ribosomal protein S15a 9986
528 6HCJ 27 X2 Ribosomal protein S15a 9986
529 6HCM 24 X1 Ribosomal protein S15a 9986
530 6HCF 24 X1 Ribosomal protein S15a 9986
531 6HA1 38 h 30S ribosomal protein S8 1423
532 6HA8 40 h 30S ribosomal protein S8 1423
533 6H58 39 h, hh 30S ribosomal protein S8 562
534 6H4N 8 h 30S ribosomal protein S8 562
535 6DZI 8 q 30S ribosomal protein S8 1772
536 6DZK 8 H 30S ribosomal protein S8 1772
537 6GZX 38 H3, H4 30S ribosomal protein S8 274
538 6GZZ 38 H3, H4 30S ribosomal protein S8 274
539 6GZQ 38 H2 30S ribosomal protein S8 274
540 6GZ3 33 BW Ribosomal protein S15a 9986
541 6GZ4 36 BW ribosomal protein uS8 9986
542 6GZ5 33 BW ribosomal protein uS8 9986
543 6GXM 41 h 30S ribosomal protein S8 562
544 6GXN 41 h 30S ribosomal protein S8 562
545 6GXO 41 h 30S ribosomal protein S8 562
546 6GXP 40 h 30S ribosomal protein S8 562
547 6GWT 41 h 30S ribosomal protein S8 562
548 6GSL 8 72, 7E 30S ribosomal protein S8 274
549 6GSM 26 W 40S ribosomal protein S22 28985
550 6GSN 40 W 40S ribosomal protein S22 28985
551 6GQV 70 AM 40S ribosomal protein S22-A 4932
552 6GQ1 70 AM 40S ribosomal protein S22-A 4932
553 6GQB 70 AM 40S ribosomal protein S22-A 4932
554 6DNC 45 UA 30S ribosomal protein S8 562
555 6D9J 72 XX uS8 9986
556 6D90 73 XX uS8 9986
557 5ZLU 15 N 30S ribosomal protein S8 274
558 6G5H 14 W 40S ribosomal protein S15a 9606
559 6G5I 24 W 40S ribosomal protein S15a 9606
560 6G4S 19 W 40S ribosomal protein S15a 9606
561 6G4W 16 W 40S ribosomal protein S15a 9606
562 6G51 15 W 40S ribosomal protein S15a 9606
563 6G53 15 W 40S ribosomal protein S15a 9606
564 6G18 25 W 40S ribosomal protein S15a 9606
565 6FYX 26 W 40S ribosomal protein S22 28985
566 6FYY 26 W 40S ribosomal protein S22 28985
567 6FXC 8 Ah, Bh 30S ribosomal protein S8 1280
568 5ZEU 5 h 30S ribosomal protein S8 1772
569 5ZEB 5 h 30S ribosomal protein S8 1772
570 5ZEP 5 h 30S ribosomal protein S8 1772
571 6C4I 41 h 30S ribosomal protein S8 562
572 6FEC 29 a 40S ribosomal protein S15a 9606
573 6FAI 33 W 40S ribosomal protein S22-A 4932
574 6BU8 38 H 30S ribosomal protein S8 562
575 6BOH 42 RA, WC 30S ribosomal protein S8 274
576 6BOK 41 PA, SC 30S ribosomal protein S8 274
577 6ERI 41 BH 30S ribosomal protein S8, chloroplastic 3562
578 6ENU 8 h 30S ribosomal protein S8 562
579 6ENJ 38 h 30S ribosomal protein S8 562
580 6ENF 8 h 30S ribosomal protein S8 562
581 6EML 24 b 40S ribosomal protein S22-A 4932
582 6B4V 42 QA, UC 30S ribosomal protein S8 274
583 6EK0 76 SW 40S ribosomal protein S15a 9606
584 6AZ1 10 J ribosomal protein S8 5661
585 6AWB 13 K 30S ribosomal protein S8 562
586 6AWC 13 K 30S ribosomal protein S8 562
587 6AWD 12 K 30S ribosomal protein S8 562
588 5OT7 14 G 30S ribosomal protein S8 274
589 5OQL 45 w 40S ribosomal protein S22-like protein 209285
590 5OPT 22 e 40S ribosomal protein S15a, putative 5693
591 5WLC 13 LE rpS22_uS8 4932
592 5WFK 41 h 30S ribosomal protein S8 562
593 5WFS 41 h 30S ribosomal protein S8 562
594 5WF0 41 h 30S ribosomal protein S8 562
595 5XYU 7 H 30S ribosomal protein S8 1772
596 5XYI 24 W Ribosomal protein S15a 5722
597 5WE4 41 h 30S ribosomal protein S8 562
598 5WE6 41 h 30S ribosomal protein S8 562
599 5WDT 41 h 30S ribosomal protein S8 562
600 5XXU 24 W Ribosomal protein uS8 5811
601 5OA3 27 W 40S ribosomal protein S15a 9606
602 5O61 42 BH 30S ribosomal protein S8 1772
603 5O5J 8 H 30S ribosomal protein S8 1772
604 5O2R 42 h 30S ribosomal protein S8 562
605 5NWY 42 7 30S ribosomal protein S8 562
606 5VPP 37 QH, XH 30S ribosomal protein S8 274
607 5NP6 11 K 30S ribosomal protein S8 562
608 5NO2 6 H 30S ribosomal protein S8 562
609 5NO3 7 H 30S ribosomal protein S8 562
610 5NO4 7 H 30S ribosomal protein S8 562
611 5NJT 8 H 30S ribosomal protein S8 1423
612 5V93 39 h 30S ribosomal protein S8 1773
613 5NGM 8 Ah 30S ribosomal protein S8 1280
614 5ND8 8 h 30S ribosomal protein S8 1280
615 5ND9 8 h 30S ribosomal protein S8 1280
616 5X8P 38 h 30S ribosomal protein S8, chloroplastic 3562
617 5X8R 6 h 30S ribosomal protein S8, chloroplastic 3562
618 5UYK 38 H 30S ribosomal protein S8 562
619 5UYL 38 H 30S ribosomal protein S8 562
620 5UYM 38 H 30S ribosomal protein S8 562
621 5UYN 38 H 30S ribosomal protein S8 562
622 5UYP 38 H 30S ribosomal protein S8 562
623 5UYQ 38 H 30S ribosomal protein S8 562
624 5UZ4 7 H 30S ribosomal protein S8 562
625 5UQ7 39 h 30S ribosomal protein S8 274
626 5UQ8 39 h 30S ribosomal protein S8 274
627 5MYJ 8 AH 30S ribosomal protein S8 1358
628 5MY1 7 H 30S ribosomal protein S8 562
629 5WYJ 47 SX 40S ribosomal protein S22-A 4932
630 5WYK 43 SX 40S ribosomal protein S22-A 4932
631 5U9F 46 H 30S ribosomal protein S8 562
632 5U9G 46 H 30S ribosomal protein S8 562
633 5MMM 44 h 30S ribosomal protein S8, chloroplastic 3562
634 5MMJ 10 h 30S ribosomal protein S8, chloroplastic 3562
635 5U4I 39 h 30S ribosomal protein S8 Gene Name(s): rpsH b3306 JW3268 562
636 5TZS 14 E rpS22_uS8 4932
637 5MGP 39 h 30S ribosomal protein S8 562
638 5ME0 8 H 30S ribosomal protein S8 Taken from PDB entry 4YBB 562
639 5ME1 8 H 30S ribosomal protein S8 Taken from PDB entry 4YBB 562
640 5MDV 45 m 30S ribosomal protein S8 562
641 5MDW 45 m 30S ribosomal protein S8 562
642 5MDY 45 m 30S ribosomal protein S8 562
643 5MDZ 43 m 30S ribosomal protein S8 562
644 5H5U 46 o 30S ribosomal protein S8 562
645 5MC6 29 b 40S ribosomal protein S22-A 4932
646 5M1J 30 W2 40S ribosomal protein S22-A 4932
647 5LZS 73 WW uS8 9986
648 5LZT 74 WW uS8 9986
649 5LZU 73 WW uS8 9986
650 5LZV 74 WW uS8 9986
651 5LZW 74 WW uS8 9986
652 5LZX 74 WW uS8 9986
653 5LZY 72 WW uS8 9986
654 5LZZ 74 WW uS8 9986
655 5LZA 8 h 30S ribosomal protein S8 562
656 5LZB 8 h 30S ribosomal protein S8 562
657 5LZC 8 h 30S ribosomal protein S8 562
658 5LZD 8 h 30S ribosomal protein S8 562
659 5LZE 8 h 30S ribosomal protein S8 562
660 5LZF 8 h 30S ribosomal protein S8 562
661 5TCU 7 SF 30S ribosomal protein S8 1280
662 5T7V 13 SF 30S ribosomal protein S8 1280
663 5T2A 65 AJ uS8 5661
664 5T2C 57 AP 40S ribosomal protein S15a 9606
665 5LMN 8 H 30S ribosomal protein S8 Uniprot code Q5SHQ2 274
666 5LMO 8 H 30S ribosomal protein S8 274
667 5LMP 8 H 30S ribosomal protein S8 274
668 5LMQ 8 H 30S ribosomal protein S8 274
669 5LMR 8 H 30S ribosomal protein S8 274
670 5LMS 8 H 30S ribosomal protein S8 274
671 5LMT 8 H 30S ribosomal protein S8 274
672 5LMU 8 H 30S ribosomal protein S8 274
673 5LMV 8 H 30S ribosomal protein S8 274
674 5LL6 14 b 40S ribosomal protein S22-A 4932
675 5LKS 75 SW 40S ribosomal protein S15a 9606
676 5LI0 8 h 30S ribosomal protein S8 1280
677 5KPS 39 13 30S ribosomal protein S8 562
678 5KPV 38 12 30S ribosomal protein S8 562
679 5KPW 38 12 30S ribosomal protein S8 562
680 5KPX 38 12 30S ribosomal protein S8 562
681 5KCR 40 1h 30S ribosomal protein S8 562
682 5KCS 42 1h 30S ribosomal protein S8 562
683 5L3P 39 h 30S ribosomal protein S8 562
684 5K0Y 23 a ribosomal protein uS8 9986
685 5JU8 8 AH 30S ribosomal protein S8 562
686 5JUO 72 TB uS8 (yeast S22) 4932
687 5JUP 72 TB uS8 (yeast S22) 4932
688 5JUS 72 TB uS8 (yeast S22) 4932
689 5JUT 72 TB uS8 (yeast S22) 4932
690 5JUU 72 TB uS8 (yeast S22) 4932
691 5JTE 8 AH 30S ribosomal protein S8 562
692 5JPQ 32 z uS8 209285
693 5JB3 15 I 30S ribosomal protein S8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
694 5JBH 26 I 30S ribosomal protein uS8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
695 5IT7 70 W 40S ribosomal protein S22 28985
696 5IT9 23 W Ribosomal protein uS8 28985
697 5IQR 38 m 30S ribosomal protein S8 562
698 5IMQ 15 L 30S ribosomal protein S8 274
699 5IMR 8 L 30S ribosomal protein S8 274
700 3JCN 41 k 30S ribosomal protein S8 562
701 3JCJ 46 p 30S ribosomal protein S8 562
702 3JCD 7 h 30S ribosomal protein S8 562
703 3JCE 7 h 30S ribosomal protein S8 562
704 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
705 3JBU 7 H 30S ribosomal protein S8 562
706 3JBV 8 H 30S ribosomal protein S8 562
707 3JBN 7 K 40S ribosomal protein uS8 5833
708 3JBO 29 K 40S ribosomal protein uS8 5833
709 3JBP 7 K 40S ribosomal protein uS8 5833
710 5A9Z 41 BL 30S ribosomal protein S8 274
711 5AA0 41 BL 30S ribosomal protein S8 274
712 3JAP 26 W uS8 28985
713 3JAQ 26 W uS8 28985
714 3JAM 24 W uS8 28985
715 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
716 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
717 3JAG 74 WW uS8 9986
718 3JAH 74 WW uS8 9986
719 3JAI 74 WW uS8 9986
720 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
721 3JA1 8 SH 30S ribosomal protein S8 562
722 3J9Z 22 SH 30S ribosomal protein S8 562
723 3J9Y 6 h 30S ribosomal protein S8 562
724 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
725 3J9W 8 AH 30S ribosomal protein uS8 1423
726 5AJ0 72 BW 40S ribosomal protein S15a