5VYC

Crystal structure of the human 40S ribosomal subunit in complex with DENR-MCT-1.


Sequence Similarity Clusters for the Entities in PDB 5VYC

Entity #1 | Chains: T1,T2,T3,T4,T5,T6
40S ribosomal protein S19 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 43 1080
95 % 1 85 698
90 % 1 85 721
70 % 1 85 752
50 % 1 87 764
40 % 1 87 792
30 % 3 90 775
Entity #10 | Chains: C1,C2,C3,C4,C5,C6
40S ribosomal protein S2 protein, length: 293 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 27 1779
95 % 1 40 1578
90 % 1 52 1239
70 % 1 53 1258
50 % 1 56 1236
40 % 1 56 1274
30 % 1 56 1308
Entity #11 | Chains: G1,G2,G3,G4,G5,G6
40S ribosomal protein S6 protein, length: 249 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 527
95 % 1 85 689
90 % 1 85 723
70 % 1 91 698
50 % 39 182 296
40 % 39 187 289
30 % 39 187 306
Entity #12 | Chains: J1,J2,J3,J4,J5,J6
40S ribosomal protein S9 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 515
95 % 1 85 683
90 % 1 85 710
70 % 39 185 250
50 % 41 200 236
40 % 41 208 236
30 % 41 208 246
Entity #13 | Chains: M1,M2,M3,M4,M5,M6
40S ribosomal protein S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 64 716
95 % 1 77 766
90 % 1 77 807
70 % 1 82 778
50 % 1 83 805
40 % 1 83 833
30 % 1 83 871
Entity #14 | Chains: N1,N2,N3,N4,N5,N6
40S ribosomal protein S13 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 518
95 % 1 85 690
90 % 1 85 709
70 % 39 190 248
50 % 41 197 246
40 % 41 205 239
30 % 41 206 248
Entity #15 | Chains: O1,O2,O3,O4,O5,O6
40S ribosomal protein S14 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 73 607
95 % 1 73 820
90 % 1 81 765
70 % 41 198 227
50 % 41 199 238
40 % 41 199 247
30 % 41 199 259
Entity #16 | Chains: W1,W2,W3,W4,W5,W6
40S ribosomal protein S15a protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 502
95 % 1 86 679
90 % 1 86 704
70 % 40 201 234
50 % 42 203 231
40 % 43 212 230
30 % 391 808 23
Entity #17 | Chains: Y1,Y2,Y3,Y4,Y5,Y6
40S ribosomal protein S24 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 576
95 % 1 85 701
90 % 1 85 733
70 % 1 86 738
50 % 38 192 267
40 % 38 192 280
30 % 38 192 292
Entity #18 | Chains: Z1,Z2,Z3,Z4,Z5,Z6
40S ribosomal protein S25 protein, length: 125 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 57 813
95 % 1 57 1086
90 % 1 57 1129
70 % 1 58 1151
50 % 1 58 1192
40 % 1 59 1213
30 % 1 59 1257
Entity #19 | Chains: b1,b2,b3,b4,b5,b6
40S ribosomal protein S27 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 517
95 % 1 85 696
90 % 1 85 716
70 % 38 175 270
50 % 40 187 268
40 % 40 187 281
30 % 40 187 295
Entity #2 | Chains: U1,U2,U3,U4,U5,U6
40S ribosomal protein S20 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 885
95 % 1 56 1104
90 % 1 56 1149
70 % 1 57 1170
50 % 1 59 1162
40 % 1 59 1193
30 % 1 59 1234
Entity #20 | Chains: e1,e2,e3,e4,e5,e6
40S ribosomal protein S30 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 13434
95 % 1 31 1996
90 % 1 31 2014
70 % 1 31 2066
50 % 1 32 2068
40 % 1 32 2095
30 % 1 32 2126
Entity #21 | Chains: i1,i2,i3,i4,i5,i6
Human 18S ribosomal RNA rna, length: 1869 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: A1,A2,A3,A4,A5,A6
40S ribosomal protein SA protein, length: 295 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1879
95 % 1 54 1162
90 % 1 54 1208
70 % 1 54 1235
50 % 1 54 1283
40 % 1 54 1312
30 % 1 54 1357
Entity #23 | Chains: B1,B2,B3,B4,B5,B6
40S ribosomal protein S3a protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 920
95 % 1 58 1081
90 % 1 58 1122
70 % 1 58 1159
50 % 1 60 1153
40 % 40 161 336
30 % 40 161 355
Entity #24 | Chains: D1,D2,D3,D4,D5,D6
40S ribosomal protein S3 protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 41 1136
95 % 1 73 815
90 % 1 73 847
70 % 1 74 875
50 % 40 168 323
40 % 40 168 332
30 % 40 168 349
Entity #25 | Chains: E1,E2,E3,E4,E5,E6
40S ribosomal protein S4, X isoform protein, length: 263 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 875
95 % 1 73 819
90 % 1 85 718
70 % 38 181 261
50 % 40 191 255
40 % 40 195 258
30 % 40 204 254
Entity #26 | Chains: F1,F2,F3,F4,F5,F6
40S ribosomal protein S5 protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 507
95 % 1 86 676
90 % 1 86 701
70 % 1 101 616
50 % 41 201 234
40 % 41 201 244
30 % 41 201 258
Entity #27 | Chains: H1,H2,H3,H4,H5,H6
40S ribosomal protein S7 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 521
95 % 1 85 693
90 % 1 85 725
70 % 1 86 737
50 % 38 188 272
40 % 38 188 285
30 % 40 191 282
Entity #28 | Chains: I1,I2,I3,I4,I5,I6
40S ribosomal protein S8 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 571
95 % 1 85 682
90 % 1 85 711
70 % 1 85 746
50 % 40 190 260
40 % 40 194 260
30 % 40 194 272
Entity #29 | Chains: K1,K2,K3,K4,K5,K6
40S ribosomal protein S10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 925
95 % 1 53 1173
90 % 1 53 1215
70 % 1 53 1245
50 % 1 54 1269
40 % 1 55 1283
30 % 1 55 1318
Entity #3 | Chains: V1,V2,V3,V4,V5,V6
40S ribosomal protein S21 protein, length: 83 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 65 701
95 % 1 84 708
90 % 1 84 737
70 % 1 85 750
50 % 38 171 317
40 % 38 171 327
30 % 38 171 341
Entity #30 | Chains: L1,L2,L3,L4,L5,L6
40S ribosomal protein S11 protein, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 497
95 % 1 86 673
90 % 1 86 702
70 % 1 87 729
50 % 41 197 244
40 % 41 197 253
30 % 41 197 264
Entity #31 | Chains: P1,P2,P3,P4,P5,P6
40S ribosomal protein S15 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 31 1548
95 % 1 84 705
90 % 1 84 739
70 % 1 86 741
50 % 40 179 302
40 % 40 187 286
30 % 40 187 304
Entity #32 | Chains: Q1,Q2,Q3,Q4,Q5,Q6
40S ribosomal protein S16 protein, length: 146 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 76 585
95 % 1 76 784
90 % 1 76 818
70 % 1 79 812
50 % 41 190 253
40 % 41 198 249
30 % 41 199 260
Entity #33 | Chains: R1,R2,R3,R4,R5,R6
40S ribosomal protein S17 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 29 1666
95 % 1 85 691
90 % 1 85 724
70 % 1 86 743
50 % 40 176 304
40 % 40 176 310
30 % 40 176 327
Entity #34 | Chains: S1,S2,S3,S4,S5,S6
40S ribosomal protein S18 protein, length: 152 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 496
95 % 1 86 672
90 % 1 86 700
70 % 39 183 254
50 % 41 192 252
40 % 41 202 242
30 % 41 202 255
Entity #35 | Chains: j1,j2,j3,j4,j5,j6
60S ribosomal protein L41 protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 554
95 % 1 82 724
90 % 1 82 756
70 % 38 163 284
50 % 38 163 334
40 % 38 163 344
30 % 38 163 361
Entity #36 | Chains: k1,k2,k3,k4,k5,k6
Malignant T-cell-amplified sequence 1 protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 11984
95 % 4 4 4065
90 % 4 4 4116
70 % 4 4 4092
50 % 4 4 4034
40 % 4 4 3988
30 % 4 4 3898
Entity #37 | Chains: l1,l2,l3,l4,l5,l6
Density-regulated protein protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 5346
95 % 3 3 6334
90 % 3 3 6429
70 % 3 3 6325
50 % 3 3 6068
40 % 3 3 5909
30 % 3 3 5621
Entity #4 | Chains: X1,X2,X3,X4,X5,X6
40S ribosomal protein S23 protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 522
95 % 1 88 659
90 % 1 89 677
70 % 41 204 222
50 % 41 214 221
40 % 41 214 227
30 % 41 214 235
Entity #5 | Chains: a1,a2,a3,a4,a5,a6
40S ribosomal protein S26 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 35 1334
95 % 1 49 1287
90 % 1 49 1326
70 % 1 50 1327
50 % 3 81 780
40 % 5 83 753
30 % 5 83 786
Entity #6 | Chains: c1,c2,c3,c4,c5,c6
40S ribosomal protein S28 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 67 678
95 % 1 67 906
90 % 1 67 941
70 % 39 191 247
50 % 41 202 232
40 % 41 203 241
30 % 41 203 252
Entity #7 | Chains: d1,d2,d3,d4,d5,d6
40S ribosomal protein S29 protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 557
95 % 1 83 712
90 % 1 83 750
70 % 39 168 281
50 % 41 176 294
40 % 41 176 305
30 % 41 176 325
Entity #8 | Chains: f1,f2,f3,f4,f5,f6
Ribosomal protein S27a protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 12188
95 % 1 50 1258
90 % 1 50 1295
70 % 4 82 724
50 % 6 86 729
40 % 6 89 728
30 % 6 89 758
Entity #9 | Chains: g1,g2,g3,g4,g5,g6
Receptor of activated protein C kinase 1 protein, length: 317 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 85 495
95 % 2 85 663
90 % 2 85 693
70 % 3 87 711
50 % 46 176 280
40 % 48 182 271
30 % 48 183 283

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 1I6U 2 A, B 30S RIBOSOMAL PROTEIN S8P 2190
2 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
3 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
4 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
5 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
6 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
15 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
16 5DAT 24 D2 40S ribosomal protein S22-A 4932
17 5DAT 80 d2 40S ribosomal protein S22-A 4932
18 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
19 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
20 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
21 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
22 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
23 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
24 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
25 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
26 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
27 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
28 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
29 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
30 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
31 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
33 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
34 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
35 4BTS 18 AH, BH, CH, DH 40S RIBOSOMAL PROTEIN RPS22E 5911
36 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
37 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
38 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
39 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
40 4V5O 17 AH, BH RIBOSOMAL PROTEIN S8 CONTAINING PROTEIN 5911
41 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
42 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
43 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
44 4KZZ 23 W 40S Ribosomal Protein S15A 9986
45 4KZX 23 W 40S ribosomal protein S15A 9986
46 4KZY 23 W 40S Ribosomal Protein S15A 9986
47 6YAL 23 Y 40S ribosomal protein uS8 9986
48 6YAM 23 Y 40S ribosomal protein uS8 9986
49 6YAN 22 Y Ribosomal protein S15a 9986
50 6W2S 15 X uS8 9986
51 6W2T 14 X uS8 9986
52 6Y7C 22 W 40S ribosomal protein S22-A 4932
53 6Y57 71 SW 40S ribosomal protein S15a 9606
54 6Y2L 71 SW 40S ribosomal protein S15a 9606
55 6Y0G 72 SW 40S ribosomal protein S15a 9606
56 6TNU 26 b 40S ribosomal protein S22-A 4932
57 6TMF 10 J 30S ribosomal protein S8 2264
58 6UZ7 70 W 40S ribosomal protein S22 28985
59 6TB3 26 b 40S ribosomal protein S22-A 4932
60 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
61 6T7T 26 SW 40S ribosomal protein S22-A 4932
62 6T7I 24 SW 40S ribosomal protein S22-A 4932
63 6T4Q 23 SW 40S ribosomal protein S22-A 4932
64 6SW9 10 I 30S ribosomal protein S8 29292
65 6SWC 10 I 30S ribosomal protein S8 29292
66 6SWD 9 I 30S ribosomal protein S8 29292
67 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
68 6SNT 24 W 40S ribosomal protein S22-A 4932
69 6SGC 24 X1 Ribosomal protein S15a 9986
70 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
71 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
72 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
73 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
74 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
75 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
76 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
77 6P5I 24 X uS8 9986
78 6P5J 24 X uS8 9986
79 6P5K 70 X uS8 9986
80 6P5N 70 X uS8 9986
81 6P4G 24 X uS8 9986
82 6P4H 25 X uS8 9986
83 6OM7 29 SW 40S ribosomal protein S15a 9606
84 6OLZ 69 BW 40S ribosomal protein S15a 9606
85 6OM0 29 SW 40S ribosomal protein S15a 9606
86 6OLE 29 SW 40S ribosomal protein S15a 9606
87 6OLF 29 SW 40S ribosomal protein S15a 9606
88 6OLG 72 BW 40S ribosomal protein S15a 9606
89 6OLI 29 SW 40S ribosomal protein S15a 9606
90 6OKK 11 K 40S ribosomal protein S15A 5833
91 6RBD 15 W 40S ribosomal protein S22-A 4932
92 6RBE 15 W 40S ribosomal protein S22-A 4932
93 6R7Q 82 TT Ribosomal protein S15a 9986
94 6R6G 50 TT Ribosomal protein S15a 9986
95 6R6P 66 TT Ribosomal protein S15a 9986
96 6R5Q 74 TT Ribosomal protein S15a 9986
97 6QZP 76 SW 40S ribosomal protein S15a 9606
98 6Q8Y 27 b 40S ribosomal protein S22-A 4932
99 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
100 6IP5 75 3M 40S ribosomal protein S15a 9606
101 6IP6 74 3M 40S ribosomal protein S15a 9606
102 6IP8 74 3M 40S ribosomal protein S15a 9606
103 6MTB 73 WW 40S ribosomal protein S15a 9986
104 6MTC 72 WW 40S ribosomal protein S15a 9986
105 6MTD 74 WW uS8 9986
106 6MTE 73 WW uS8 9986
107 6HCQ 27 X2 Ribosomal protein S15a 9986
108 6HCJ 27 X2 Ribosomal protein S15a 9986
109 6HCM 24 X1 Ribosomal protein S15a 9986
110 6HCF 24 X1 Ribosomal protein S15a 9986
111 6GZ3 33 BW Ribosomal protein S15a 9986
112 6GZ4 36 BW ribosomal protein uS8 9986
113 6GZ5 33 BW ribosomal protein uS8 9986
114 6GSM 26 W 40S ribosomal protein S22 28985
115 6GSN 40 W 40S ribosomal protein S22 28985
116 6GQV 70 AM 40S ribosomal protein S22-A 4932
117 6GQ1 70 AM 40S ribosomal protein S22-A 4932
118 6GQB 70 AM 40S ribosomal protein S22-A 4932
119 6D9J 72 XX uS8 9986
120 6D90 73 XX uS8 9986
121 6G5H 14 W 40S ribosomal protein S15a 9606
122 6G5I 24 W 40S ribosomal protein S15a 9606
123 6G4S 19 W 40S ribosomal protein S15a 9606
124 6G4W 16 W 40S ribosomal protein S15a 9606
125 6G51 15 W 40S ribosomal protein S15a 9606
126 6G53 15 W 40S ribosomal protein S15a 9606
127 6G18 25 W 40S ribosomal protein S15a 9606
128 6FYX 26 W 40S ribosomal protein S22 28985
129 6FYY 26 W 40S ribosomal protein S22 28985
130 6FEC 29 a 40S ribosomal protein S15a 9606
131 6FAI 33 W 40S ribosomal protein S22-A 4932
132 6EML 24 b 40S ribosomal protein S22-A 4932
133 6EK0 76 SW 40S ribosomal protein S15a 9606
134 6AZ1 10 J ribosomal protein S8 5661
135 5OQL 45 w 40S ribosomal protein S22-like protein 209285
136 5OPT 22 e 40S ribosomal protein S15a, putative 5693
137 5WLC 13 LE rpS22_uS8 4932
138 5XYI 24 W Ribosomal protein S15a 5722
139 5XXU 24 W Ribosomal protein uS8 5811
140 5OA3 27 W 40S ribosomal protein S15a 9606
141 5WYJ 47 SX 40S ribosomal protein S22-A 4932
142 5WYK 43 SX 40S ribosomal protein S22-A 4932
143 5TZS 14 E rpS22_uS8 4932
144 5MC6 29 b 40S ribosomal protein S22-A 4932
145 5M1J 30 W2 40S ribosomal protein S22-A 4932
146 5LZS 73 WW uS8 9986
147 5LZT 74 WW uS8 9986
148 5LZU 73 WW uS8 9986
149 5LZV 74 WW uS8 9986
150 5LZW 74 WW uS8 9986
151 5LZX 74 WW uS8 9986
152 5LZY 72 WW uS8 9986
153 5LZZ 74 WW uS8 9986
154 5T2A 65 AJ uS8 5661
155 5T2C 57 AP 40S ribosomal protein S15a 9606
156 5LL6 14 b 40S ribosomal protein S22-A 4932
157 5LKS 75 SW 40S ribosomal protein S15a 9606
158 5K0Y 23 a ribosomal protein uS8 9986
159 5JUO 72 TB uS8 (yeast S22) 4932
160 5JUP 72 TB uS8 (yeast S22) 4932
161 5JUS 72 TB uS8 (yeast S22) 4932
162 5JUT 72 TB uS8 (yeast S22) 4932
163 5JUU 72 TB uS8 (yeast S22) 4932
164 5JPQ 32 z uS8 209285
165 5JB3 15 I 30S ribosomal protein S8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
166 5JBH 26 I 30S ribosomal protein uS8 30S ribosomal protein uS8 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
167 5IT7 70 W 40S ribosomal protein S22 28985
168 5IT9 23 W Ribosomal protein uS8 28985
169 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
170 3JBN 7 K 40S ribosomal protein uS8 5833
171 3JBO 29 K 40S ribosomal protein uS8 5833
172 3JBP 7 K 40S ribosomal protein uS8 5833
173 3JAP 26 W uS8 28985
174 3JAQ 26 W uS8 28985
175 3JAM 24 W uS8 28985
176 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
177 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
178 3JAG 74 WW uS8 9986
179 3JAH 74 WW uS8 9986
180 3JAI 74 WW uS8 9986
181 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
182 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
183 5AJ0 72 BW 40S ribosomal protein S15a 9606
184 4UER 18 H US8 4934
185 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
186 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
187 4V3P 27 SH Ribosomal protein S15 4565
188 3J81 24 W uS8 28985
189 3J80 14 W uS8 28985
190 3J7P 72 SW Ribosomal protein uS8 9823
191 3J7R 73 SW Ribosomal protein uS8 9823
192 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
193 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
194 3J7A 11 K 40S ribosomal protein uS8 5833
195 3J77 68 22 40S ribosomal protein S22 4932
196 3J78 68 22 40S ribosomal protein S22 4932
197 3J6X 69 22 40S ribosomal protein S22 4932
198 3J6Y 69 22 40S ribosomal protein S22 4932
199 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
200 4V92 25 BW US8 28985
201 4V7E 24 BW 40S ribosomal protein S8 4565
202 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
203 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
204 4V4N 21 BI 30S ribosomal protein S8P SEE REMARK 999 2190
205 4V6W 32 AW 40S ribosomal protein S15Aa 7227
206 4V6X 32 AW 40S ribosomal protein S15a 9606
207 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
208 4V6U 3 AI 30S ribosomal protein S8P 2261
209 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
210 4V7H 7 AH 40S ribosomal protein S22(A) 5541
211 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
212 4V4B 8 AH 40S ribosomal protein S22 4932