5VYC

Crystal structure of the human 40S ribosomal subunit in complex with DENR-MCT-1.


Sequence Similarity Clusters for the Entities in PDB 5VYC

Entity #1 | Chains: T1,T2,T3,T4,T5,T6
40S ribosomal protein S19 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 43 1080
95 % 1 85 698
90 % 1 85 721
70 % 1 85 752
50 % 1 87 764
40 % 1 87 792
30 % 3 90 775
Entity #10 | Chains: C1,C2,C3,C4,C5,C6
40S ribosomal protein S2 protein, length: 293 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 27 1779
95 % 1 40 1578
90 % 1 52 1239
70 % 1 53 1258
50 % 1 56 1236
40 % 1 56 1274
30 % 1 56 1308
Entity #11 | Chains: G1,G2,G3,G4,G5,G6
40S ribosomal protein S6 protein, length: 249 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 527
95 % 1 85 689
90 % 1 85 723
70 % 1 91 698
50 % 39 182 296
40 % 39 187 289
30 % 39 187 306
Entity #12 | Chains: J1,J2,J3,J4,J5,J6
40S ribosomal protein S9 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 515
95 % 1 85 683
90 % 1 85 710
70 % 39 185 250
50 % 41 200 236
40 % 41 208 236
30 % 41 208 246
Entity #13 | Chains: M1,M2,M3,M4,M5,M6
40S ribosomal protein S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 64 716
95 % 1 77 766
90 % 1 77 807
70 % 1 82 778
50 % 1 83 805
40 % 1 83 833
30 % 1 83 871
Entity #14 | Chains: N1,N2,N3,N4,N5,N6
40S ribosomal protein S13 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 518
95 % 1 85 690
90 % 1 85 709
70 % 39 190 248
50 % 41 197 246
40 % 41 205 239
30 % 41 206 248
Entity #15 | Chains: O1,O2,O3,O4,O5,O6
40S ribosomal protein S14 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 73 607
95 % 1 73 820
90 % 1 81 765
70 % 41 198 227
50 % 41 199 238
40 % 41 199 247
30 % 41 199 259
Entity #16 | Chains: W1,W2,W3,W4,W5,W6
40S ribosomal protein S15a protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 502
95 % 1 86 679
90 % 1 86 704
70 % 40 201 234
50 % 42 203 231
40 % 43 212 230
30 % 391 808 23
Entity #17 | Chains: Y1,Y2,Y3,Y4,Y5,Y6
40S ribosomal protein S24 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 576
95 % 1 85 701
90 % 1 85 733
70 % 1 86 738
50 % 38 192 267
40 % 38 192 280
30 % 38 192 292
Entity #18 | Chains: Z1,Z2,Z3,Z4,Z5,Z6
40S ribosomal protein S25 protein, length: 125 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 57 813
95 % 1 57 1086
90 % 1 57 1129
70 % 1 58 1151
50 % 1 58 1192
40 % 1 59 1213
30 % 1 59 1257
Entity #19 | Chains: b1,b2,b3,b4,b5,b6
40S ribosomal protein S27 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 517
95 % 1 85 696
90 % 1 85 716
70 % 38 175 270
50 % 40 187 268
40 % 40 187 281
30 % 40 187 295
Entity #2 | Chains: U1,U2,U3,U4,U5,U6
40S ribosomal protein S20 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 885
95 % 1 56 1104
90 % 1 56 1149
70 % 1 57 1170
50 % 1 59 1162
40 % 1 59 1193
30 % 1 59 1234
Entity #20 | Chains: e1,e2,e3,e4,e5,e6
40S ribosomal protein S30 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 13434
95 % 1 31 1996
90 % 1 31 2014
70 % 1 31 2066
50 % 1 32 2068
40 % 1 32 2095
30 % 1 32 2126
Entity #21 | Chains: i1,i2,i3,i4,i5,i6
Human 18S ribosomal RNA rna, length: 1869 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: A1,A2,A3,A4,A5,A6
40S ribosomal protein SA protein, length: 295 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1879
95 % 1 54 1162
90 % 1 54 1208
70 % 1 54 1235
50 % 1 54 1283
40 % 1 54 1312
30 % 1 54 1357
Entity #23 | Chains: B1,B2,B3,B4,B5,B6
40S ribosomal protein S3a protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 920
95 % 1 58 1081
90 % 1 58 1122
70 % 1 58 1159
50 % 1 60 1153
40 % 40 161 336
30 % 40 161 355
Entity #24 | Chains: D1,D2,D3,D4,D5,D6
40S ribosomal protein S3 protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 41 1136
95 % 1 73 815
90 % 1 73 847
70 % 1 74 875
50 % 40 168 323
40 % 40 168 332
30 % 40 168 349
Entity #25 | Chains: E1,E2,E3,E4,E5,E6
40S ribosomal protein S4, X isoform protein, length: 263 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 875
95 % 1 73 819
90 % 1 85 718
70 % 38 181 261
50 % 40 191 255
40 % 40 195 258
30 % 40 204 254
Entity #26 | Chains: F1,F2,F3,F4,F5,F6
40S ribosomal protein S5 protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 507
95 % 1 86 676
90 % 1 86 701
70 % 1 101 616
50 % 41 201 234
40 % 41 201 244
30 % 41 201 258
Entity #27 | Chains: H1,H2,H3,H4,H5,H6
40S ribosomal protein S7 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 521
95 % 1 85 693
90 % 1 85 725
70 % 1 86 737
50 % 38 188 272
40 % 38 188 285
30 % 40 191 282
Entity #28 | Chains: I1,I2,I3,I4,I5,I6
40S ribosomal protein S8 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 571
95 % 1 85 682
90 % 1 85 711
70 % 1 85 746
50 % 40 190 260
40 % 40 194 260
30 % 40 194 272
Entity #29 | Chains: K1,K2,K3,K4,K5,K6
40S ribosomal protein S10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 925
95 % 1 53 1173
90 % 1 53 1215
70 % 1 53 1245
50 % 1 54 1269
40 % 1 55 1283
30 % 1 55 1318
Entity #3 | Chains: V1,V2,V3,V4,V5,V6
40S ribosomal protein S21 protein, length: 83 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 65 701
95 % 1 84 708
90 % 1 84 737
70 % 1 85 750
50 % 38 171 317
40 % 38 171 327
30 % 38 171 341
Entity #30 | Chains: L1,L2,L3,L4,L5,L6
40S ribosomal protein S11 protein, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 497
95 % 1 86 673
90 % 1 86 702
70 % 1 87 729
50 % 41 197 244
40 % 41 197 253
30 % 41 197 264
Entity #31 | Chains: P1,P2,P3,P4,P5,P6
40S ribosomal protein S15 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 31 1548
95 % 1 84 705
90 % 1 84 739
70 % 1 86 741
50 % 40 179 302
40 % 40 187 286
30 % 40 187 304
Entity #32 | Chains: Q1,Q2,Q3,Q4,Q5,Q6
40S ribosomal protein S16 protein, length: 146 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 76 585
95 % 1 76 784
90 % 1 76 818
70 % 1 79 812
50 % 41 190 253
40 % 41 198 249
30 % 41 199 260
Entity #33 | Chains: R1,R2,R3,R4,R5,R6
40S ribosomal protein S17 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 29 1666
95 % 1 85 691
90 % 1 85 724
70 % 1 86 743
50 % 40 176 304
40 % 40 176 310
30 % 40 176 327
Entity #34 | Chains: S1,S2,S3,S4,S5,S6
40S ribosomal protein S18 protein, length: 152 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 496
95 % 1 86 672
90 % 1 86 700
70 % 39 183 254
50 % 41 192 252
40 % 41 202 242
30 % 41 202 255
Entity #35 | Chains: j1,j2,j3,j4,j5,j6
60S ribosomal protein L41 protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 554
95 % 1 82 724
90 % 1 82 756
70 % 38 163 284
50 % 38 163 334
40 % 38 163 344
30 % 38 163 361
Entity #36 | Chains: k1,k2,k3,k4,k5,k6
Malignant T-cell-amplified sequence 1 protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 11984
95 % 4 4 4065
90 % 4 4 4116
70 % 4 4 4092
50 % 4 4 4034
40 % 4 4 3988
30 % 4 4 3898
Entity #37 | Chains: l1,l2,l3,l4,l5,l6
Density-regulated protein protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 5346
95 % 3 3 6334
90 % 3 3 6429
70 % 3 3 6325
50 % 3 3 6068
40 % 3 3 5909
30 % 3 3 5621
Entity #4 | Chains: X1,X2,X3,X4,X5,X6
40S ribosomal protein S23 protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 522
95 % 1 88 659
90 % 1 89 677
70 % 41 204 222
50 % 41 214 221
40 % 41 214 227
30 % 41 214 235
Entity #5 | Chains: a1,a2,a3,a4,a5,a6
40S ribosomal protein S26 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 35 1334
95 % 1 49 1287
90 % 1 49 1326
70 % 1 50 1327
50 % 3 81 780
40 % 5 83 753
30 % 5 83 786
Entity #6 | Chains: c1,c2,c3,c4,c5,c6
40S ribosomal protein S28 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 67 678
95 % 1 67 906
90 % 1 67 941
70 % 39 191 247
50 % 41 202 232
40 % 41 203 241
30 % 41 203 252
Entity #7 | Chains: d1,d2,d3,d4,d5,d6
40S ribosomal protein S29 protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 557
95 % 1 83 712
90 % 1 83 750
70 % 39 168 281
50 % 41 176 294
40 % 41 176 305
30 % 41 176 325
Entity #8 | Chains: f1,f2,f3,f4,f5,f6
Ribosomal protein S27a protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 12188
95 % 1 50 1258
90 % 1 50 1295
70 % 4 82 724
50 % 6 86 729
40 % 6 89 728
30 % 6 89 758
Entity #9 | Chains: g1,g2,g3,g4,g5,g6
Receptor of activated protein C kinase 1 protein, length: 317 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 85 495
95 % 2 85 663
90 % 2 85 693
70 % 3 87 711
50 % 46 176 280
40 % 48 182 271
30 % 48 183 283

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 24 AW, CW 40S ribosomal protein S22-A 4932
2 4U4R 24 D2, d2 40S ribosomal protein S22-A 4932
3 4U3U 24 D2, d2 40S ribosomal protein S22-A 4932
4 5TBW 71 X, d2 40S ribosomal protein S22-A 4932
5 4U3M 24 D2, d2 40S ribosomal protein S22-A 4932
6 4U3N 24 D2, d2 40S ribosomal protein S22-A 4932
7 4U52 24 D2, d2 40S ribosomal protein S22-A 4932
8 4U4Q 24 D2, d2 40S ribosomal protein S22-A 4932
9 4U6F 24 D2, d2 40S ribosomal protein S22-A 4932
10 4U4U 24 D2, d2 40S ribosomal protein S22-A 4932
11 4U4Z 24 D2, d2 40S ribosomal protein S22-A 4932
12 4U4Y 24 D2, d2 40S ribosomal protein S22-A 4932
13 4U4N 24 D2, d2 40S ribosomal protein S22-A 4932
14 4U55 24 D2, d2 40S ribosomal protein S22-A 4932
15 5DAT 24 D2 40S ribosomal protein S22-A 4932
16 5DAT 80 d2 40S ribosomal protein S22-A 4932
17 5I4L 24 D2, d2 40S ribosomal protein S22-A 4932
18 4U51 24 D2, d2 40S ribosomal protein S22-A 4932
19 6HHQ 70 X, d2 40S ribosomal protein S22-A 4932
20 5OBM 68 D2, d2 40S ribosomal protein S22-A 4932
21 4U53 24 D2, d2 40S ribosomal protein S22-A 4932
22 5ON6 72 X, d2 40S ribosomal protein S22-A 4932
23 4U50 24 D2, d2 40S ribosomal protein S22-A 4932
24 5NDV 68 D2, d2 40S ribosomal protein S22-A 4932
25 5LYB 24 D2, d2 40S ribosomal protein S22-A 4932
26 4U56 24 D2, d2 40S ribosomal protein S22-A 4932
27 5TGA 24 D2, d2 40S ribosomal protein S22-A 4932
28 5MEI 71 X, d2 40S ribosomal protein S22-A 4932
29 5FCJ 24 D2, d2 40S ribosomal protein S22-A 4932
30 4U4O 24 D2, d2 40S ribosomal protein S22-A 4932
31 5DGV 24 D2, d2 40S ribosomal protein S22-A 4932
32 5DGE 24 D2, d2 40S ribosomal protein S22-A 4932
33 5NDW 17 D2, d2 40S ribosomal protein S22-A 4932
34 5NDG 24 D2, d2 40S ribosomal protein S22-A 4932
35 5FCI 24 D2, d2 40S ribosomal protein S22-A 4932
36 5DC3 24 D2, d2 40S ribosomal protein S22-A 4932
37 5DGF 24 D2, d2 40S ribosomal protein S22-A 4932
38 5TGM 24 D2, d2 40S ribosomal protein S22-A 4932
39 4V7R 16 AO, CO 40S ribosomal protein S22-A 4932
40 5VYC 16 W1, W2, W3, W4, W5, W6 40S ribosomal protein S15a 9606
41 4KZZ 23 W 40S Ribosomal Protein S15A 9986
42 4KZX 23 W 40S ribosomal protein S15A 9986
43 4KZY 23 W 40S Ribosomal Protein S15A 9986
44 6YAL 23 Y 40S ribosomal protein uS8 9986
45 6YAM 23 Y 40S ribosomal protein uS8 9986
46 6YAN 22 Y Ribosomal protein S15a 9986
47 6W2S 15 X uS8 9986
48 6W2T 14 X uS8 9986
49 6Y7C 22 W 40S ribosomal protein S22-A 4932
50 6Y57 71 SW 40S ribosomal protein S15a 9606
51 6Y2L 71 SW 40S ribosomal protein S15a 9606
52 6Y0G 72 SW 40S ribosomal protein S15a 9606
53 6TNU 26 b 40S ribosomal protein S22-A 4932
54 6UZ7 70 W 40S ribosomal protein S22 28985
55 6TB3 26 b 40S ribosomal protein S22-A 4932
56 6T83 24 Wb, x 40S ribosomal protein S22-A 4932
57 6T7T 26 SW 40S ribosomal protein S22-A 4932
58 6T7I 24 SW 40S ribosomal protein S22-A 4932
59 6T4Q 23 SW 40S ribosomal protein S22-A 4932
60 6SV4 41 b, bb, bc 40S ribosomal protein S22-A 4932
61 6SNT 24 W 40S ribosomal protein S22-A 4932
62 6SGC 24 X1 Ribosomal protein S15a 9986
63 6S47 68 BX 40S ribosomal protein S22-A TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH VSGKILGFVY 4932
64 6RXT 41 Cm 40S ribosomal protein S22-like protein 209285
65 6RXU 45 Cm 40S ribosomal protein S22-like protein 209285
66 6RXV 45 Cm 40S ribosomal protein S22-like protein 209285
67 6RXX 26 Cm 40S ribosomal protein S22-like protein 209285
68 6RXY 40 Cm 40S ribosomal protein S22-like protein 209285
69 6RXZ 44 Cm 40S ribosomal protein S22-like protein 209285
70 6P5I 24 X uS8 9986
71 6P5J 24 X uS8 9986
72 6P5K 70 X uS8 9986
73 6P5N 70 X uS8 9986
74 6P4G 24 X uS8 9986
75 6P4H 25 X uS8 9986
76 6OM7 29 SW 40S ribosomal protein S15a 9606
77 6OLZ 69 BW 40S ribosomal protein S15a 9606
78 6OM0 29 SW 40S ribosomal protein S15a 9606
79 6OLE 29 SW 40S ribosomal protein S15a 9606
80 6OLF 29 SW 40S ribosomal protein S15a 9606
81 6OLG 72 BW 40S ribosomal protein S15a 9606
82 6OLI 29 SW 40S ribosomal protein S15a 9606
83 6OKK 11 K 40S ribosomal protein S15A 5833
84 6RBD 15 W 40S ribosomal protein S22-A 4932
85 6RBE 15 W 40S ribosomal protein S22-A 4932
86 6R7Q 82 TT Ribosomal protein S15a 9986
87 6R6G 50 TT Ribosomal protein S15a 9986
88 6R6P 66 TT Ribosomal protein S15a 9986
89 6R5Q 74 TT Ribosomal protein S15a 9986
90 6QZP 76 SW 40S ribosomal protein S15a 9606
91 6Q8Y 27 b 40S ribosomal protein S22-A 4932
92 6I7O 41 b, bb 40S ribosomal protein S22-A 4932
93 6IP5 75 3M 40S ribosomal protein S15a 9606
94 6IP6 74 3M 40S ribosomal protein S15a 9606
95 6IP8 74 3M 40S ribosomal protein S15a 9606
96 6MTB 73 WW 40S ribosomal protein S15a 9986
97 6MTC 72 WW 40S ribosomal protein S15a 9986
98 6MTD 74 WW uS8 9986
99 6MTE 73 WW uS8 9986
100 6HCQ 27 X2 Ribosomal protein S15a 9986
101 6HCJ 27 X2 Ribosomal protein S15a 9986
102 6HCM 24 X1 Ribosomal protein S15a 9986
103 6HCF 24 X1 Ribosomal protein S15a 9986
104 6GZ3 33 BW Ribosomal protein S15a 9986
105 6GZ4 36 BW ribosomal protein uS8 9986
106 6GZ5 33 BW ribosomal protein uS8 9986
107 6GSM 26 W 40S ribosomal protein S22 28985
108 6GSN 40 W 40S ribosomal protein S22 28985
109 6GQV 70 AM 40S ribosomal protein S22-A 4932
110 6GQ1 70 AM 40S ribosomal protein S22-A 4932
111 6GQB 70 AM 40S ribosomal protein S22-A 4932
112 6D9J 72 XX uS8 9986
113 6D90 73 XX uS8 9986
114 6G5H 14 W 40S ribosomal protein S15a 9606
115 6G5I 24 W 40S ribosomal protein S15a 9606
116 6G4S 19 W 40S ribosomal protein S15a 9606
117 6G4W 16 W 40S ribosomal protein S15a 9606
118 6G51 15 W 40S ribosomal protein S15a 9606
119 6G53 15 W 40S ribosomal protein S15a 9606
120 6G18 25 W 40S ribosomal protein S15a 9606
121 6FYX 26 W 40S ribosomal protein S22 28985
122 6FYY 26 W 40S ribosomal protein S22 28985
123 6FEC 29 a 40S ribosomal protein S15a 9606
124 6FAI 33 W 40S ribosomal protein S22-A 4932
125 6EML 24 b 40S ribosomal protein S22-A 4932
126 6EK0 76 SW 40S ribosomal protein S15a 9606
127 6AZ1 10 J ribosomal protein S8 5661
128 5OQL 45 w 40S ribosomal protein S22-like protein 209285
129 5OPT 22 e 40S ribosomal protein S15a, putative 5693
130 5WLC 13 LE rpS22_uS8 4932
131 5XYI 24 W Ribosomal protein S15a 5722
132 5XXU 24 W Ribosomal protein uS8 5811
133 5OA3 27 W 40S ribosomal protein S15a 9606
134 5WYJ 47 SX 40S ribosomal protein S22-A 4932
135 5WYK 43 SX 40S ribosomal protein S22-A 4932
136 5TZS 14 E rpS22_uS8 4932
137 5MC6 29 b 40S ribosomal protein S22-A 4932
138 5M1J 30 W2 40S ribosomal protein S22-A 4932
139 5LZS 73 WW uS8 9986
140 5LZT 74 WW uS8 9986
141 5LZU 73 WW uS8 9986
142 5LZV 74 WW uS8 9986
143 5LZW 74 WW uS8 9986
144 5LZX 74 WW uS8 9986
145 5LZY 72 WW uS8 9986
146 5LZZ 74 WW uS8 9986
147 5T2A 65 AJ uS8 5661
148 5T2C 57 AP 40S ribosomal protein S15a 9606
149 5LL6 14 b 40S ribosomal protein S22-A 4932
150 5LKS 75 SW 40S ribosomal protein S15a 9606
151 5K0Y 23 a ribosomal protein uS8 9986
152 5JUO 72 TB uS8 (yeast S22) 4932
153 5JUP 72 TB uS8 (yeast S22) 4932
154 5JUS 72 TB uS8 (yeast S22) 4932
155 5JUT 72 TB uS8 (yeast S22) 4932
156 5JUU 72 TB uS8 (yeast S22) 4932
157 5JPQ 32 z uS8 209285
158 5IT7 70 W 40S ribosomal protein S22 28985
159 5IT9 23 W Ribosomal protein uS8 28985
160 5FLX 24 W 40S RIBOSOMAL PROTEIN S15A 9986
161 3JBN 7 K 40S ribosomal protein uS8 5833
162 3JBO 29 K 40S ribosomal protein uS8 5833
163 3JBP 7 K 40S ribosomal protein uS8 5833
164 3JAP 26 W uS8 28985
165 3JAQ 26 W uS8 28985
166 3JAM 24 W uS8 28985
167 3JAN 66 SW Ribosomal protein uS8 SEE REMARK 999 9986
168 3JAJ 67 SW Ribosomal protein uS8 SEE REMARK 999 9986
169 3JAG 74 WW uS8 9986
170 3JAH 74 WW uS8 9986
171 3JAI 74 WW uS8 9986
172 5A2Q 25 W RIBOSOMAL PROTEIN US8 9606
173 4UG0 77 SW 40S RIBOSOMAL PROTEIN S15A 9606
174 5AJ0 72 BW 40S ribosomal protein S15a 9606
175 4UER 18 H US8 4934
176 4D61 24 W 40S RIBOSOMAL PROTEIN S15A 9986
177 4D5L 24 W 40S RIBOSOMAL PROTEIN US8 9986
178 4V3P 27 SH Ribosomal protein S15 4565
179 3J81 24 W uS8 28985
180 3J80 14 W uS8 28985
181 3J7P 72 SW Ribosomal protein uS8 9823
182 3J7R 73 SW Ribosomal protein uS8 9823
183 4UJC 73 CW 40S RIBOSOMAL PROTEIN US8 9986
184 4UJD 73 CW 40S RIBOSOMAL PROTEIN US8 9986
185 3J7A 11 K 40S ribosomal protein uS8 5833
186 3J77 68 22 40S ribosomal protein S22 4932
187 3J78 68 22 40S ribosomal protein S22 4932
188 3J6X 69 22 40S ribosomal protein S22 4932
189 3J6Y 69 22 40S ribosomal protein S22 4932
190 4UJE 27 BW 40S RIBOSOMAL PROTEIN S15A 9986
191 4V92 25 BW US8 28985
192 4V7E 24 BW 40S ribosomal protein S8 4565
193 4V8Y 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
194 4V8Z 31 AW 40S RIBOSOMAL PROTEIN S22-A 4932
195 4V6W 32 AW 40S ribosomal protein S15Aa 7227
196 4V6X 32 AW 40S ribosomal protein S15a 9606
197 4V8M 18 AJ 40S RIBOSOMAL PROTEIN S15A, PUTATIVE 185431
198 4V6I 9 AH 40S ribosomal protein rpS22 (S8p) 4932
199 4V7H 7 AH 40S ribosomal protein S22(A) 5541
200 4V5Z 15 Ah 40S Ribosomal protein S15ae 9612
201 4V4B 8 AH 40S ribosomal protein S22 4932