5VYC

Crystal structure of the human 40S ribosomal subunit in complex with DENR-MCT-1.


Sequence Similarity Clusters for the Entities in PDB 5VYC

Entity #1 | Chains: T1,T2,T3,T4,T5,T6
40S ribosomal protein S19 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 43 1080
95 % 1 85 698
90 % 1 85 721
70 % 1 85 752
50 % 1 87 764
40 % 1 87 792
30 % 3 90 775
Entity #10 | Chains: C1,C2,C3,C4,C5,C6
40S ribosomal protein S2 protein, length: 293 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 27 1779
95 % 1 40 1578
90 % 1 52 1239
70 % 1 53 1258
50 % 1 56 1236
40 % 1 56 1274
30 % 1 56 1308
Entity #11 | Chains: G1,G2,G3,G4,G5,G6
40S ribosomal protein S6 protein, length: 249 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 527
95 % 1 85 689
90 % 1 85 723
70 % 1 91 698
50 % 39 182 296
40 % 39 187 289
30 % 39 187 306
Entity #12 | Chains: J1,J2,J3,J4,J5,J6
40S ribosomal protein S9 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 515
95 % 1 85 683
90 % 1 85 710
70 % 39 185 250
50 % 41 200 236
40 % 41 208 236
30 % 41 208 246
Entity #13 | Chains: M1,M2,M3,M4,M5,M6
40S ribosomal protein S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 64 716
95 % 1 77 766
90 % 1 77 807
70 % 1 82 778
50 % 1 83 805
40 % 1 83 833
30 % 1 83 871
Entity #14 | Chains: N1,N2,N3,N4,N5,N6
40S ribosomal protein S13 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 518
95 % 1 85 690
90 % 1 85 709
70 % 39 190 248
50 % 41 197 246
40 % 41 205 239
30 % 41 206 248
Entity #15 | Chains: O1,O2,O3,O4,O5,O6
40S ribosomal protein S14 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 73 607
95 % 1 73 820
90 % 1 81 765
70 % 41 198 227
50 % 41 199 238
40 % 41 199 247
30 % 41 199 259
Entity #16 | Chains: W1,W2,W3,W4,W5,W6
40S ribosomal protein S15a protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 502
95 % 1 86 679
90 % 1 86 704
70 % 40 201 234
50 % 42 203 231
40 % 43 212 230
30 % 391 808 23
Entity #17 | Chains: Y1,Y2,Y3,Y4,Y5,Y6
40S ribosomal protein S24 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 576
95 % 1 85 701
90 % 1 85 733
70 % 1 86 738
50 % 38 192 267
40 % 38 192 280
30 % 38 192 292
Entity #18 | Chains: Z1,Z2,Z3,Z4,Z5,Z6
40S ribosomal protein S25 protein, length: 125 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 57 813
95 % 1 57 1086
90 % 1 57 1129
70 % 1 58 1151
50 % 1 58 1192
40 % 1 59 1213
30 % 1 59 1257
Entity #19 | Chains: b1,b2,b3,b4,b5,b6
40S ribosomal protein S27 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 517
95 % 1 85 696
90 % 1 85 716
70 % 38 175 270
50 % 40 187 268
40 % 40 187 281
30 % 40 187 295
Entity #2 | Chains: U1,U2,U3,U4,U5,U6
40S ribosomal protein S20 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 885
95 % 1 56 1104
90 % 1 56 1149
70 % 1 57 1170
50 % 1 59 1162
40 % 1 59 1193
30 % 1 59 1234
Entity #20 | Chains: e1,e2,e3,e4,e5,e6
40S ribosomal protein S30 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 13434
95 % 1 31 1996
90 % 1 31 2014
70 % 1 31 2066
50 % 1 32 2068
40 % 1 32 2095
30 % 1 32 2126
Entity #21 | Chains: i1,i2,i3,i4,i5,i6
Human 18S ribosomal RNA rna, length: 1869 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: A1,A2,A3,A4,A5,A6
40S ribosomal protein SA protein, length: 295 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1879
95 % 1 54 1162
90 % 1 54 1208
70 % 1 54 1235
50 % 1 54 1283
40 % 1 54 1312
30 % 1 54 1357
Entity #23 | Chains: B1,B2,B3,B4,B5,B6
40S ribosomal protein S3a protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 920
95 % 1 58 1081
90 % 1 58 1122
70 % 1 58 1159
50 % 1 60 1153
40 % 40 161 336
30 % 40 161 355
Entity #24 | Chains: D1,D2,D3,D4,D5,D6
40S ribosomal protein S3 protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 41 1136
95 % 1 73 815
90 % 1 73 847
70 % 1 74 875
50 % 40 168 323
40 % 40 168 332
30 % 40 168 349
Entity #25 | Chains: E1,E2,E3,E4,E5,E6
40S ribosomal protein S4, X isoform protein, length: 263 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 875
95 % 1 73 819
90 % 1 85 718
70 % 38 181 261
50 % 40 191 255
40 % 40 195 258
30 % 40 204 254
Entity #26 | Chains: F1,F2,F3,F4,F5,F6
40S ribosomal protein S5 protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 507
95 % 1 86 676
90 % 1 86 701
70 % 1 101 616
50 % 41 201 234
40 % 41 201 244
30 % 41 201 258
Entity #27 | Chains: H1,H2,H3,H4,H5,H6
40S ribosomal protein S7 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 521
95 % 1 85 693
90 % 1 85 725
70 % 1 86 737
50 % 38 188 272
40 % 38 188 285
30 % 40 191 282
Entity #28 | Chains: I1,I2,I3,I4,I5,I6
40S ribosomal protein S8 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 571
95 % 1 85 682
90 % 1 85 711
70 % 1 85 746
50 % 40 190 260
40 % 40 194 260
30 % 40 194 272
Entity #29 | Chains: K1,K2,K3,K4,K5,K6
40S ribosomal protein S10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 925
95 % 1 53 1173
90 % 1 53 1215
70 % 1 53 1245
50 % 1 54 1269
40 % 1 55 1283
30 % 1 55 1318
Entity #3 | Chains: V1,V2,V3,V4,V5,V6
40S ribosomal protein S21 protein, length: 83 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 65 701
95 % 1 84 708
90 % 1 84 737
70 % 1 85 750
50 % 38 171 317
40 % 38 171 327
30 % 38 171 341
Entity #30 | Chains: L1,L2,L3,L4,L5,L6
40S ribosomal protein S11 protein, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 497
95 % 1 86 673
90 % 1 86 702
70 % 1 87 729
50 % 41 197 244
40 % 41 197 253
30 % 41 197 264
Entity #31 | Chains: P1,P2,P3,P4,P5,P6
40S ribosomal protein S15 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 31 1548
95 % 1 84 705
90 % 1 84 739
70 % 1 86 741
50 % 40 179 302
40 % 40 187 286
30 % 40 187 304
Entity #32 | Chains: Q1,Q2,Q3,Q4,Q5,Q6
40S ribosomal protein S16 protein, length: 146 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 76 585
95 % 1 76 784
90 % 1 76 818
70 % 1 79 812
50 % 41 190 253
40 % 41 198 249
30 % 41 199 260
Entity #33 | Chains: R1,R2,R3,R4,R5,R6
40S ribosomal protein S17 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 29 1666
95 % 1 85 691
90 % 1 85 724
70 % 1 86 743
50 % 40 176 304
40 % 40 176 310
30 % 40 176 327
Entity #34 | Chains: S1,S2,S3,S4,S5,S6
40S ribosomal protein S18 protein, length: 152 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 496
95 % 1 86 672
90 % 1 86 700
70 % 39 183 254
50 % 41 192 252
40 % 41 202 242
30 % 41 202 255
Entity #35 | Chains: j1,j2,j3,j4,j5,j6
60S ribosomal protein L41 protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 554
95 % 1 82 724
90 % 1 82 756
70 % 38 163 284
50 % 38 163 334
40 % 38 163 344
30 % 38 163 361
Entity #36 | Chains: k1,k2,k3,k4,k5,k6
Malignant T-cell-amplified sequence 1 protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 11984
95 % 4 4 4065
90 % 4 4 4116
70 % 4 4 4092
50 % 4 4 4034
40 % 4 4 3988
30 % 4 4 3898
Entity #37 | Chains: l1,l2,l3,l4,l5,l6
Density-regulated protein protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 5346
95 % 3 3 6334
90 % 3 3 6429
70 % 3 3 6325
50 % 3 3 6068
40 % 3 3 5909
30 % 3 3 5621
Entity #4 | Chains: X1,X2,X3,X4,X5,X6
40S ribosomal protein S23 protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 522
95 % 1 88 659
90 % 1 89 677
70 % 41 204 222
50 % 41 214 221
40 % 41 214 227
30 % 41 214 235
Entity #5 | Chains: a1,a2,a3,a4,a5,a6
40S ribosomal protein S26 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 35 1334
95 % 1 49 1287
90 % 1 49 1326
70 % 1 50 1327
50 % 3 81 780
40 % 5 83 753
30 % 5 83 786
Entity #6 | Chains: c1,c2,c3,c4,c5,c6
40S ribosomal protein S28 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 67 678
95 % 1 67 906
90 % 1 67 941
70 % 39 191 247
50 % 41 202 232
40 % 41 203 241
30 % 41 203 252
Entity #7 | Chains: d1,d2,d3,d4,d5,d6
40S ribosomal protein S29 protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 557
95 % 1 83 712
90 % 1 83 750
70 % 39 168 281
50 % 41 176 294
40 % 41 176 305
30 % 41 176 325
Entity #8 | Chains: f1,f2,f3,f4,f5,f6
Ribosomal protein S27a protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 12188
95 % 1 50 1258
90 % 1 50 1295
70 % 4 82 724
50 % 6 86 729
40 % 6 89 728
30 % 6 89 758
Entity #9 | Chains: g1,g2,g3,g4,g5,g6
Receptor of activated protein C kinase 1 protein, length: 317 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 85 495
95 % 2 85 663
90 % 2 85 693
70 % 3 87 711
50 % 46 180 280
40 % 48 182 271
30 % 48 183 283

Instructions

In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.



View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures


ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 13 AL, CL 40S ribosomal protein S11-A 4932
2 4U4R 13 C1, c1 40S ribosomal protein S11-A 4932
3 4U3U 13 C1, c1 40S ribosomal protein S11-A 4932
4 5TBW 60 M, c1 40S ribosomal protein S11-A 4932
5 4U3M 13 C1, c1 40S ribosomal protein S11-A 4932
6 4U3N 13 C1, c1 40S ribosomal protein S11-A 4932
7 4U52 13 C1, c1 40S ribosomal protein S11-A 4932
8 4U4Q 13 C1, c1 40S ribosomal protein S11-A 4932
9 4U6F 13 C1, c1 40S ribosomal protein S11-A 4932
10 4U4U 13 C1, c1 40S ribosomal protein S11-A 4932
11 4U4Z 13 C1, c1 40S ribosomal protein S11-A 4932
12 4U4Y 13 C1, c1 40S ribosomal protein S11-A 4932
13 4U4N 13 C1, c1 40S ribosomal protein S11-A 4932
14 4U55 13 C1, c1 40S ribosomal protein S11-A 4932
15 5DAT 13 C1, c1 40S ribosomal protein S11-A 4932
16 5I4L 13 C1, c1 40S ribosomal protein S11-A 4932
17 4U51 13 C1, c1 40S ribosomal protein S11-A 4932
18 6HHQ 59 M, c1 40S ribosomal protein S11-A 4932
19 5OBM 57 C1, c1 40S ribosomal protein S11-A 4932
20 4U53 13 C1, c1 40S ribosomal protein S11-A 4932
21 5ON6 61 M, c1 40S ribosomal protein S11-A 4932
22 4U50 13 C1, c1 40S ribosomal protein S11-A 4932
23 5NDV 57 C1, c1 40S ribosomal protein S11-A 4932
24 5LYB 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S Ribosomal Protein S11-A 4932
25 4U56 13 C1, c1 40S ribosomal protein S11-A 4932
26 5TGA 13 C1, c1 40S ribosomal protein S11-A 4932
27 5MEI 60 M, c1 40S ribosomal protein S11-A 4932
28 5FCJ 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
29 4U4O 13 C1, c1 40S ribosomal protein S11-A 4932
30 5DGV 13 C1, c1 40S ribosomal protein S11-A 4932
31 5DGE 13 C1, c1 40S ribosomal protein S11-A 4932
32 5NDW 6 C1, c1 40S ribosomal protein S11-A 4932
33 4BTS 27 AQ, BQ, CQ, DQ 40S RIBOSOMAL PROTEIN RPS11E 5911
34 5NDG 13 C1, c1 40S ribosomal protein S11-A 4932
35 5FCI 13 C1, c1 40S ribosomal protein S11-A,40S ribosomal protein S11-A (uS17) (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMH RTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAAKANKQFAKF 4932
36 5DC3 13 C1, c1 40S ribosomal protein S11-A 4932
37 5DGF 13 C1, c1 40S ribosomal protein S11-A 4932
38 4V5O 26 AQ, BQ RIBOSOMAL PROTEIN S17 CONTAINING PROTEIN 5911
39 5TGM 13 C1, c1 40S ribosomal protein S11-A,40S Ribosomal Protein S11 4932
40 4V7R 7 AF, CF 40S ribosomal protein S11 4932
41 5VYC 30 L1, L2, L3, L4, L5, L6 40S ribosomal protein S11 9606
42 4KZZ 12 L 40S Ribosomal Protein S11 9986
43 4KZX 12 L 40S ribosomal protein S11 9986
44 4KZY 12 L 40S Ribosomal Protein S11 9986
45 6YAL 14 N 40S ribosomal protein uS17 9986
46 6YAM 14 N 40S ribosomal protein uS17 9986
47 6YAN 13 N Ribosomal protein S11 9986
48 6W2S 11 M uS17 9986
49 6W2T 10 M uS17 9986
50 6Y7C 11 L 40S ribosomal protein S11-A 4932
51 6Y57 61 SL 40S ribosomal protein S11 9606
52 6Y2L 61 SL 40S ribosomal protein S11 9606
53 6Y0G 61 SL 40S ribosomal protein S11 9606
54 6TNU 15 X 40S ribosomal protein S11-A 4932
55 6UZ7 59 L KLLA0A10483p 28985
56 6TB3 15 X 40S ribosomal protein S11-A 4932
57 6T83 14 Lb, m 40S ribosomal protein S11-A 4932
58 6T7T 16 SL 40S ribosomal protein S11-A 4932
59 6T7I 14 SL 40S ribosomal protein S11-A 4932
60 6T4Q 13 SL 40S ribosomal protein S11-A 4932
61 6SV4 30 X, Xb, Xc 40S ribosomal protein S11-A 4932
62 6SNT 14 L 40S ribosomal protein S11-A 4932
63 6SGC 13 M1 Ribosomal protein S11 9986
64 6S47 57 BM 40S ribosomal protein S11-A 4932
65 6RXU 44 Ck 40S ribosomal protein S11-like protein 209285
66 6RXV 44 Ck 40S ribosomal protein S11-like protein 209285
67 6RXX 41 Ck 40S ribosomal protein S11-like protein 209285
68 6RXZ 43 Ck 40S ribosomal protein S11-like protein 209285
69 6P5I 13 M uS17 9986
70 6P5J 13 M uS17 9986
71 6P5K 59 M uS17 9986
72 6P5N 59 M uS17 9986
73 6P4G 13 M uS17 9986
74 6P4H 14 M uS17 9986
75 6OM7 10 SL 40S ribosomal protein S11 9606
76 6OLZ 58 BL 40S ribosomal protein S11 9606
77 6OM0 10 SL 40S ribosomal protein S11 9606
78 6OLE 10 SL 40S ribosomal protein S11 9606
79 6OLF 10 SL 40S ribosomal protein S11 9606
80 6OLG 61 BL 40S ribosomal protein S11 9606
81 6OLI 10 SL 40S ribosomal protein S11 9606
82 6OKK 22 V 40S ribosomal protein S11 5833
83 6RBD 12 L 40S ribosomal protein S11-A 4932
84 6RBE 10 L 40S ribosomal protein S11-A 4932
85 6R7Q 5 EE Ribosomal protein S11 9986
86 6R6G 19 EE Ribosomal protein S11 9986
87 6R6P 60 EE Ribosomal protein S11 9986
88 6R5Q 63 EE Ribosomal protein S11 9986
89 6QZP 57 SL 40S ribosomal protein S11 9606
90 6Q8Y 79 X 40S ribosomal protein S11-A 4932
91 6I7O 30 X, Xb 40S ribosomal protein S11-A 4932
92 6IP5 56 2v 40S ribosomal protein S11 9606
93 6IP6 55 2v 40S ribosomal protein S11 9606
94 6IP8 55 2v 40S ribosomal protein S11 9606
95 6MTB 62 LL 40S ribosomal protein S11 9986
96 6MTC 61 LL 40S ribosomal protein S11 9986
97 6MTD 63 LL uS17 9986
98 6MTE 62 LL uS17 9986
99 6HCQ 16 M2 Ribosomal protein S11 9986
100 6HCJ 16 M2 Ribosomal protein S11 9986
101 6HCM 13 M1 Ribosomal protein S11 9986
102 6HCF 13 M1 Ribosomal protein S11 9986
103 6GZ3 29 BL Ribosomal protein S11 9986
104 6GZ4 32 BL ribosomal protein uS17 9986
105 6GZ5 29 BL ribosomal protein uS17 9986
106 6GSM 15 L KLLA0A10483p 28985
107 6GSN 36 L KLLA0A10483p 28985
108 6GQV 59 AB 40S ribosomal protein S11-A 4932
109 6GQ1 59 AB 40S ribosomal protein S11-A 4932
110 6GQB 59 AB 40S ribosomal protein S11-A 4932
111 6D9J 61 MM uS17 9986
112 6D90 62 MM uS17 9986
113 6G5H 10 L 40S ribosomal protein S11 9606
114 6G5I 13 L 40S ribosomal protein S11 9606
115 6G4S 29 L 40S ribosomal protein S11 9606
116 6G4W 25 L 40S ribosomal protein S11 9606
117 6G51 11 L 40S ribosomal protein S11 9606
118 6G53 11 L 40S ribosomal protein S11 9606
119 6G18 21 L 40S ribosomal protein S11 9606
120 6FYX 15 L KLLA0A10483p 28985
121 6FYY 15 L KLLA0A10483p 28985
122 6FEC 12 G 40S ribosomal protein S11 9606
123 6FAI 22 L 40S ribosomal protein S11-A 4932
124 6EML 20 X 40S ribosomal protein S11-A 4932
125 6EK0 57 SL 40S ribosomal protein S11 9606
126 6AZ1 21 U ribosomal protein S17 5661
127 5OQL 44 v 40S ribosomal protein S11-like protein 209285
128 5OPT 16 X 40S ribosomal protein S11, putative 5693
129 5WLC 12 LD rpS11_uS17 4932
130 5XYI 13 L Uncharacterized protein 5722
131 5XXU 13 L Ribosomal protein uS17 5811
132 5OA3 16 L 40S ribosomal protein S11 9606
133 5WYJ 42 SM 40S ribosomal protein S11-A 4932
134 5WYK 39 SM 40S ribosomal protein S11-A 4932
135 5TZS 13 D rpS11_uS17 4932
136 5MC6 25 X 40S ribosomal protein S11-A 4932
137 5M1J 19 L2 40S ribosomal protein S11-A 4932
138 5LZS 62 LL uS17 9986
139 5LZT 63 LL uS17 9986
140 5LZU 62 LL uS17 9986
141 5LZV 63 LL uS17 9986
142 5LZW 63 LL uS17 9986
143 5LZX 63 LL uS17 9986
144 5LZY 61 LL uS17 9986
145 5LZZ 63 LL uS17 9986
146 5T2A 61 AE uS17 5661
147 5T2C 73 Aw 40S ribosomal protein S11 9606
148 5LL6 10 X 40S ribosomal protein S11-A 4932
149 5LKS 56 SL 40S ribosomal protein S11 9606
150 5K0Y 5 G ribosomal protein uS17 9986
151 5JUO 61 IB uS17 (yeast S11) 4932
152 5JUP 61 IB uS17 (yeast S11) 4932
153 5JUS 61 IB uS17 (yeast S11) 4932
154 5JUT 61 IB uS17 (yeast S11) 4932
155 5JUU 61 IB uS17 (yeast S11) 4932
156 5JPQ 31 y uS17 209285
157 5IT7 59 L KLLA0A10483p 28985
158 5IT9 12 L Ribosomal protein uS17 28985
159 5FLX 13 L 40S RIBOSOMAL PROTEIN S11 9986
160 3JBN 31 V 40S ribosomal protein uS17 5833
161 3JBO 8 V 40S ribosomal protein uS17 5833
162 3JBP 31 V 40S ribosomal protein uS17 5833
163 3JAP 15 L uS17 28985
164 3JAQ 15 L uS17 28985
165 3JAM 13 L uS17 28985
166 3JAN 62 SL Ribosomal protein uS17 SEE REMARK 999 9986
167 3JAJ 63 SL Ribosomal protein uS17 SEE REMARK 999 9986
168 3JAG 63 LL uS17 9986
169 3JAH 63 LL uS17 9986
170 3JAI 63 LL uS17 9986
171 5A2Q 14 L RIBOSOMAL PROTEIN US17 9606
172 4UG0 57 SL 40S RIBOSOMAL PROTEIN S11 9606
173 5AJ0 61 BL 40S ribosomal protein S11 9606
174 4UER 27 Q US17 4934
175 4D61 13 L 40S RIBOSOMAL PROTEIN S11 9986
176 4D5L 13 L 40S RIBOSOMAL PROTEIN US17 9986
177 3J81 13 L uS17 28985
178 3J80 10 L uS17 28985
179 3J7P 61 SL Ribosomal protein uS17 9823
180 3J7R 62 SL Ribosomal protein uS17 9823
181 4UJC 62 CL 40S RIBOSOMAL PROTEIN US17 9986
182 4UJD 62 CL 40S RIBOSOMAL PROTEIN US17 9986
183 3J7A 22 V 40S ribosomal protein uS17 5833
184 3J77 57 11 40S ribosomal protein S11 4932
185 3J78 57 11 40S ribosomal protein S11 4932
186 3J6X 58 11 40S ribosomal protein S11 4932
187 3J6Y 58 11 40S ribosomal protein S11 4932
188 4UJE 16 BL 40S RIBOSOMAL PROTEIN S11 9986
189 4V92 14 BL US17 28985
190 4V7E 19 BL 40S ribosomal protein S17 4565
191 4V8Y 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
192 4V8Z 20 AL 40S RIBOSOMAL PROTEIN S11-A 4932
193 4V6W 11 AL 40S ribosomal protein S11 7227
194 4V6X 11 AL 40S ribosomal protein S11 9606
195 4V8M 13 AE 40S RIBOSOMAL PROTEINS S11, PUTATIVE 185431
196 4V6I 18 AP 40S ribosomal protein rpS11 (S17p) 4932
197 4V5Z 23 Aq 40S Ribosomal protein S11e 9612