Crystal structure of the human 40S ribosomal subunit in complex with DENR-MCT-1.

Sequence Similarity Clusters for the Entities in PDB 5VYC

Entity #1 | Chains: T1,T2,T3,T4,T5,T6
40S ribosomal protein S19 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 43 1084
95 % 1 85 693
90 % 1 85 724
70 % 1 85 757
50 % 1 87 768
40 % 1 87 798
30 % 3 90 775
Entity #10 | Chains: C1,C2,C3,C4,C5,C6
40S ribosomal protein S2 protein, length: 293 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 27 1823
95 % 1 40 1577
90 % 1 52 1240
70 % 1 53 1258
50 % 1 56 1235
40 % 1 56 1261
30 % 1 56 1302
Entity #11 | Chains: G1,G2,G3,G4,G5,G6
40S ribosomal protein S6 protein, length: 249 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 529
95 % 1 85 698
90 % 1 85 729
70 % 1 91 702
50 % 39 182 294
40 % 39 187 294
30 % 39 187 311
Entity #12 | Chains: J1,J2,J3,J4,J5,J6
40S ribosomal protein S9 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 521
95 % 1 85 687
90 % 1 85 715
70 % 39 185 251
50 % 41 200 237
40 % 41 208 236
30 % 41 208 249
Entity #13 | Chains: M1,M2,M3,M4,M5,M6
40S ribosomal protein S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 64 712
95 % 1 77 768
90 % 1 77 806
70 % 1 82 783
50 % 1 83 808
40 % 1 83 838
30 % 1 83 882
Entity #14 | Chains: N1,N2,N3,N4,N5,N6
40S ribosomal protein S13 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 513
95 % 1 85 685
90 % 1 85 714
70 % 39 190 248
50 % 41 197 246
40 % 41 205 240
30 % 41 206 251
Entity #15 | Chains: O1,O2,O3,O4,O5,O6
40S ribosomal protein S14 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 73 612
95 % 1 73 820
90 % 1 81 773
70 % 41 198 231
50 % 41 199 238
40 % 41 199 250
30 % 41 199 262
Entity #16 | Chains: W1,W2,W3,W4,W5,W6
40S ribosomal protein S15a protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 509
95 % 1 86 677
90 % 1 86 706
70 % 42 203 225
50 % 42 204 230
40 % 43 214 230
30 % 391 808 22
Entity #17 | Chains: Y1,Y2,Y3,Y4,Y5,Y6
40S ribosomal protein S24 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 576
95 % 1 85 690
90 % 1 85 717
70 % 1 86 737
50 % 38 192 266
40 % 38 192 280
30 % 38 192 293
Entity #18 | Chains: Z1,Z2,Z3,Z4,Z5,Z6
40S ribosomal protein S25 protein, length: 125 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 57 810
95 % 1 57 1098
90 % 1 57 1137
70 % 1 58 1150
50 % 1 58 1208
40 % 1 59 1214
30 % 1 59 1256
Entity #19 | Chains: b1,b2,b3,b4,b5,b6
40S ribosomal protein S27 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 520
95 % 1 85 683
90 % 1 85 713
70 % 38 175 271
50 % 40 187 269
40 % 40 187 285
30 % 40 187 298
Entity #2 | Chains: U1,U2,U3,U4,U5,U6
40S ribosomal protein S20 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 887
95 % 1 56 1105
90 % 1 56 1149
70 % 1 57 1172
50 % 1 59 1164
40 % 1 59 1195
30 % 1 59 1237
Entity #20 | Chains: e1,e2,e3,e4,e5,e6
40S ribosomal protein S30 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 13142
95 % 1 31 1949
90 % 1 31 2011
70 % 1 31 2072
50 % 1 32 2082
40 % 1 32 2111
30 % 1 32 2144
Entity #21 | Chains: i1,i2,i3,i4,i5,i6
Human 18S ribosomal RNA rna, length: 1869 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: A1,A2,A3,A4,A5,A6
40S ribosomal protein SA protein, length: 295 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1880
95 % 1 54 1167
90 % 1 54 1206
70 % 1 54 1240
50 % 1 54 1283
40 % 1 54 1314
30 % 1 54 1353
Entity #23 | Chains: B1,B2,B3,B4,B5,B6
40S ribosomal protein S3a protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 925
95 % 1 58 1078
90 % 1 58 1119
70 % 1 58 1151
50 % 1 60 1156
40 % 40 161 340
30 % 40 161 361
Entity #24 | Chains: D1,D2,D3,D4,D5,D6
40S ribosomal protein S3 protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 41 1143
95 % 1 73 821
90 % 1 73 853
70 % 1 74 877
50 % 40 168 321
40 % 40 168 336
30 % 40 168 353
Entity #25 | Chains: E1,E2,E3,E4,E5,E6
40S ribosomal protein S4, X isoform protein, length: 263 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 883
95 % 1 73 812
90 % 1 85 712
70 % 38 181 261
50 % 40 191 255
40 % 40 191 267
30 % 40 199 267
Entity #26 | Chains: F1,F2,F3,F4,F5,F6
40S ribosomal protein S5 protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 505
95 % 1 86 679
90 % 1 86 707
70 % 1 101 624
50 % 41 201 235
40 % 41 201 246
30 % 41 201 260
Entity #27 | Chains: H1,H2,H3,H4,H5,H6
40S ribosomal protein S7 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 530
95 % 1 85 696
90 % 1 85 727
70 % 1 86 740
50 % 38 188 273
40 % 38 188 288
30 % 40 191 283
Entity #28 | Chains: I1,I2,I3,I4,I5,I6
40S ribosomal protein S8 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 577
95 % 1 85 702
90 % 1 85 736
70 % 1 85 756
50 % 40 190 259
40 % 40 194 262
30 % 40 194 275
Entity #29 | Chains: K1,K2,K3,K4,K5,K6
40S ribosomal protein S10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 919
95 % 1 53 1192
90 % 1 53 1215
70 % 1 53 1269
50 % 1 54 1273
40 % 1 55 1305
30 % 1 55 1339
Entity #3 | Chains: V1,V2,V3,V4,V5,V6
40S ribosomal protein S21 protein, length: 83 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 65 704
95 % 1 84 704
90 % 1 84 743
70 % 1 85 747
50 % 38 176 306
40 % 38 176 320
30 % 38 176 337
Entity #30 | Chains: L1,L2,L3,L4,L5,L6
40S ribosomal protein S11 protein, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 508
95 % 1 86 676
90 % 1 86 705
70 % 1 87 733
50 % 41 197 245
40 % 41 197 256
30 % 41 197 268
Entity #31 | Chains: P1,P2,P3,P4,P5,P6
40S ribosomal protein S15 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 31 1561
95 % 1 84 709
90 % 1 84 745
70 % 1 86 745
50 % 40 179 299
40 % 40 186 292
30 % 40 187 306
Entity #32 | Chains: Q1,Q2,Q3,Q4,Q5,Q6
40S ribosomal protein S16 protein, length: 146 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 76 587
95 % 1 76 784
90 % 1 76 826
70 % 1 79 818
50 % 41 190 253
40 % 41 198 255
30 % 41 199 263
Entity #33 | Chains: R1,R2,R3,R4,R5,R6
40S ribosomal protein S17 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 29 1663
95 % 1 85 691
90 % 1 85 718
70 % 1 86 738
50 % 40 176 301
40 % 40 176 313
30 % 40 176 332
Entity #34 | Chains: S1,S2,S3,S4,S5,S6
40S ribosomal protein S18 protein, length: 152 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 506
95 % 1 86 680
90 % 1 86 708
70 % 39 183 254
50 % 41 192 251
40 % 41 202 243
30 % 41 202 257
Entity #35 | Chains: j1,j2,j3,j4,j5,j6
60S ribosomal protein L41 protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 557
95 % 1 82 722
90 % 1 82 761
70 % 38 163 284
50 % 38 163 331
40 % 38 163 348
30 % 38 163 365
Entity #36 | Chains: k1,k2,k3,k4,k5,k6
Malignant T-cell-amplified sequence 1 protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 12031
95 % 4 4 4080
90 % 4 4 4242
70 % 4 4 4116
50 % 4 4 4153
40 % 4 4 3997
30 % 4 4 4007
Entity #37 | Chains: l1,l2,l3,l4,l5,l6
Density-regulated protein protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 5443
95 % 3 3 6028
90 % 3 3 6227
70 % 3 3 6115
50 % 3 3 5869
40 % 3 3 5589
30 % 3 3 5343
Entity #4 | Chains: X1,X2,X3,X4,X5,X6
40S ribosomal protein S23 protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 526
95 % 1 88 660
90 % 1 89 687
70 % 41 204 222
50 % 41 214 220
40 % 41 214 231
30 % 41 214 240
Entity #5 | Chains: a1,a2,a3,a4,a5,a6
40S ribosomal protein S26 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 35 1336
95 % 1 49 1281
90 % 1 49 1318
70 % 1 50 1322
50 % 3 81 779
40 % 5 83 757
30 % 5 83 792
Entity #6 | Chains: c1,c2,c3,c4,c5,c6
40S ribosomal protein S28 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 67 676
95 % 1 67 918
90 % 1 67 961
70 % 39 191 247
50 % 41 202 232
40 % 41 203 242
30 % 41 203 254
Entity #7 | Chains: d1,d2,d3,d4,d5,d6
40S ribosomal protein S29 protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 560
95 % 1 83 711
90 % 1 83 747
70 % 39 169 280
50 % 39 177 302
40 % 39 177 314
30 % 39 177 333
Entity #8 | Chains: f1,f2,f3,f4,f5,f6
Ribosomal protein S27a protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 11798
95 % 1 50 1265
90 % 1 50 1297
70 % 4 82 729
50 % 6 86 728
40 % 6 89 734
30 % 6 89 768
Entity #9 | Chains: g1,g2,g3,g4,g5,g6
Receptor of activated protein C kinase 1 protein, length: 317 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 85 500
95 % 2 85 669
90 % 2 85 700
70 % 3 87 713
50 % 46 176 281
40 % 48 182 274
30 % 48 183 285


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 17 AP, CP 40S ribosomal protein S15 4932
2 4U4R 17 C5, c5 40S ribosomal protein S15 4932
3 4U3U 17 C5, c5 40S ribosomal protein S15 4932
4 5TBW 64 Q, c5 40S ribosomal protein S15 4932
5 4U3M 17 C5, c5 40S ribosomal protein S15 4932
6 4U3N 17 C5, c5 40S ribosomal protein S15 4932
7 4U52 17 C5, c5 40S ribosomal protein S15 4932
8 4U4Q 17 C5, c5 40S ribosomal protein S15 4932
9 4U6F 17 C5, c5 40S ribosomal protein S15 4932
10 4U4U 17 C5, c5 40S ribosomal protein S15 4932
11 4U4Z 17 C5, c5 40S ribosomal protein S15 4932
12 4U4Y 17 C5, c5 40S ribosomal protein S15 4932
13 4U4N 17 C5, c5 40S ribosomal protein S15 4932
14 4U55 17 C5, c5 40S ribosomal protein S15 4932
15 5DAT 17 C5, c5 40S ribosomal protein S15 4932
16 5I4L 17 C5, c5 40S ribosomal protein S15 4932
17 4U51 17 C5, c5 40S ribosomal protein S15 4932
18 6HHQ 63 Q, c5 40S ribosomal protein S15 4932
19 5OBM 61 C5, c5 40S ribosomal protein S15 4932
20 4U53 17 C5, c5 40S ribosomal protein S15 4932
21 5ON6 65 Q, c5 40S ribosomal protein S15 4932
22 4U50 17 C5, c5 40S ribosomal protein S15 4932
23 5NDV 61 C5, c5 40S ribosomal protein S15 4932
24 5LYB 17 C5 40S ribosomal protein S15 4932
25 5LYB 82 c5 40S ribosomal protein S15 4932
26 4U56 17 C5, c5 40S ribosomal protein S15 4932
27 5TGA 17 C5, c5 40S ribosomal protein S15 4932
28 5MEI 64 Q, c5 40S ribosomal protein S15 4932
29 5FCJ 17 C5, c5 40S ribosomal protein S15 (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SQAVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMR NMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLK 4932
30 4U4O 17 C5, c5 40S ribosomal protein S15 4932
31 5DGV 17 C5, c5 40S ribosomal protein S15 4932
32 5DGE 17 C5, c5 40S ribosomal protein S15 4932
33 5NDW 10 C5, c5 40S ribosomal protein S15 4932
34 5NDG 17 C5, c5 40S ribosomal protein S15 4932
35 5FCI 17 C5, c5 40S ribosomal protein S15 (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SQAVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMR NMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLK 4932
36 5DC3 17 C5, c5 40S ribosomal protein S15 4932
37 5DGF 17 C5, c5 40S ribosomal protein S15 (uS19) 4932
38 5TGM 17 C5, c5 40S Ribosomal Protein S15,40S ribosomal protein S15,40S Ribosomal Protein S15 4932
39 4V7R 10 AI, CI 40S ribosomal protein S15 4932
40 5VYC 31 P1, P2, P3, P4, P5, P6 40S ribosomal protein S15 9606
41 4KZZ 16 P 40S Ribosomal Protein S15 9986
42 4KZX 16 P 40S ribosomal protein S15 9986
43 4KZY 16 P 40S Ribosomal Protein S15 9986
44 6YAL 40 R 40S ribosomal protein uS19 9986
45 6YAM 40 R 40S ribosomal protein uS19 9986
46 6YAN 38 R Ribosomal protein S15 9986
47 6W2S 25 Q uS19 9986
48 6W2T 24 Q uS19 9986
49 6Y7C 15 P 40S ribosomal protein S15 4932
50 6Y57 64 SP 40S ribosomal protein S15 9606
51 6Y2L 64 SP 40S ribosomal protein S15 9606
52 6Y0G 65 SP 40S ribosomal protein S15 9606
53 6TNU 5 E 40S ribosomal protein S15 4932
54 6UZ7 63 P KLLA0F07843p 28985
55 6TB3 5 E 40S ribosomal protein S15 4932
56 6T83 4 Pb, q 40S ribosomal protein S15 4932
57 6T7T 6 SP 40S ribosomal protein S15 4932
58 6T7I 4 SP 40S ribosomal protein S15 4932
59 6T4Q 3 SP 40S ribosomal protein S15 4932
60 6SW9 21 T 30S ribosomal protein S19 29292
61 6SWC 21 T 30S ribosomal protein S19 29292
62 6SWE 8 T 30S ribosomal protein S19 29292
63 6SV4 34 E, Eb, Ec 40S ribosomal protein S15 4932
64 6SNT 4 P 40S ribosomal protein S15 4932
65 6SGC 17 Q1 uS19 9986
66 6S47 61 BQ 40S ribosomal protein S15 4932
67 6P5I 17 Q uS19 9986
68 6P5J 17 Q uS19 9986
69 6P5K 63 Q uS19 9986
70 6P5N 63 Q uS19 9986
71 6P4G 17 Q uS19 9986
72 6P4H 18 Q uS19 9986
73 6RM3 54 SP0 uS19 6039
74 6OM7 11 SP 40S ribosomal protein S15 9606
75 6OLZ 62 BP 40S ribosomal protein S15 9606
76 6OM0 11 SP 40S ribosomal protein S15 9606
77 6OLE 11 SP 40S ribosomal protein S15 9606
78 6OLF 11 SP 40S ribosomal protein S15 9606
79 6OLG 65 BP 40S ribosomal protein S15 9606
80 6OLI 11 SP 40S ribosomal protein S15 9606
81 6OKK 24 X 40S ribosomal protein S19 5833
82 6RBD 28 P 40S ribosomal protein S15 4932
83 6RBE 25 P 40S ribosomal protein S15 4932
84 6R7Q 85 WW uS19 9986
85 6R6G 56 WW uS19 9986
86 6R6P 76 9 uS14 9986
87 6R5Q 67 WW uS17 9986
88 6QZP 58 SP 40S ribosomal protein S15 9606
89 6Q8Y 61 E 40S ribosomal protein S15 4932
90 6I7O 34 E, Eb 40S ribosomal protein S15 4932
91 6IP5 57 2w 40S ribosomal protein S15 9606
92 6IP6 56 2w 40S ribosomal protein S15 9606
93 6IP8 56 2w 40S ribosomal protein S15 9606
94 6MTB 66 PP 40S ribosomal protein S15 9986
95 6MTC 65 PP 40S ribosomal protein S15 9986
96 6MTD 67 PP uS19 9986
97 6MTE 66 PP uS19 9986
98 6HCQ 20 Q2 uS19 9986
99 6HCJ 20 Q2 uS19 9986
100 6HCM 17 Q1 uS19 9986
101 6HCF 17 Q1 uS19 9986
102 6GZ3 10 BP ribosomal protein uS19 9986
103 6GZ4 16 BP ribosomal protein uS19 9986
104 6GZ5 10 BP ribosomal protein uS19 9986
105 6GSM 19 P KLLA0F07843p 28985
106 6GSN 7 P KLLA0F07843p 28985
107 6GQV 63 AF 40S ribosomal protein S15 4932
108 6GQ1 63 AF 40S ribosomal protein S15 4932
109 6GQB 63 AF 40S ribosomal protein S15 4932
110 6D9J 65 QQ uS19 9986
111 6D90 66 QQ uS19 9986
112 6G5H 26 P 40S ribosomal protein S15 9606
113 6G5I 17 P 40S ribosomal protein S15 9606
114 6G4S 26 P 40S ribosomal protein S15 9606
115 6G4W 22 P 40S ribosomal protein S15 9606
116 6G51 30 P 40S ribosomal protein S15 9606
117 6G53 29 P 40S ribosomal protein S15 9606
118 6G18 4 P 40S ribosomal protein S15 9606
119 6FYX 19 P KLLA0F07843p 28985
120 6FYY 19 P KLLA0F07843p 28985
121 6FEC 42 n 40S ribosomal protein S15 9606
122 6FAI 26 P 40S ribosomal protein S15 4932
123 6EML 5 E 40S ribosomal protein S15 4932
124 6EK0 58 SP 40S ribosomal protein S15 9606
125 6AZ1 23 W ribosomal protein S19 5661
126 5OPT 4 t 40S ribosomal protein S15, putative 5693
127 5XXU 17 P Ribosomal protein uS19 5811
128 5OA3 20 P 40S ribosomal protein S15 9606
129 5MC6 6 E 40S ribosomal protein S15 4932
130 5M1J 23 P2 40S ribosomal protein S15 4932
131 5LZS 66 PP uS19 9986
132 5LZT 67 PP uS19 9986
133 5LZU 66 PP uS19 9986
134 5LZV 67 PP uS19 9986
135 5LZW 67 PP uS19 9986
136 5LZX 67 PP uS19 9986
137 5LZY 65 PP uS19 9986
138 5LZZ 67 PP uS19 9986
139 5T2A 64 AI uS19 5661
140 5T2C 74 Ax 40S ribosomal protein S15 9606
141 5LKS 57 SP 40S ribosomal protein S15 9606
142 5K0Y 36 n ribosomal protein uS19 9986
143 5JUO 65 MB uS19 (yeast S15) 4932
144 5JUP 65 MB uS19 (yeast S15) 4932
145 5JUS 65 MB uS19 (yeast S15) 4932
146 5JUT 65 MB uS19 (yeast S15) 4932
147 5JUU 65 MB uS19 (yeast S15) 4932
148 5JB3 23 T 30S ribosomal protein S19 30S ribosomal protein uS19 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
149 5JBH 8 T 30S ribosomal protein uS19 30S ribosomal protein uS19 model from Pyrococcus furiosus (PDB code 4V6U) used for fitting 29292
150 5IT7 63 P KLLA0F07843p 28985
151 5IT9 16 P Ribosomal protein uS19 28985
152 5FLX 17 P 40S RIBOSOMAL PROTEIN S15 9986
153 3JAP 19 P uS19 28985
154 3JAQ 19 P uS19 28985
155 3JAM 17 P uS19 28985
156 3JAG 67 PP uS19 9986
157 3JAH 67 PP uS19 9986
158 3JAI 67 PP uS19 9986
160 4UG0 58 SP 40S RIBOSOMAL PROTEIN S15 9606
161 5AJ0 65 BP 40S ribosomal protein S15 9606
162 4UER 29 S US19 4934
163 4D61 17 P 40S RIBOSOMAL PROTEIN S15 9986
164 4D5L 17 P 40S RIBOSOMAL PROTEIN US19 9986
165 3J81 17 P uS19 28985
166 3J80 24 P uS19 28985
167 3J7P 65 SP Ribosomal protein uS19 9823
168 3J7R 66 SP Ribosomal protein uS19 9823
171 3J7A 24 X 40S ribosomal protein uS19 5833
172 3J77 61 15 40S ribosomal protein S15 4932
173 3J78 61 15 40S ribosomal protein S15 4932
174 3J6X 62 15 40S ribosomal protein S15 4932
175 3J6Y 62 15 40S ribosomal protein S15 4932
177 4V92 18 BP US19 28985
178 4V7E 21 BP 40S ribosomal protein S19 4565
179 4V8Y 24 AP 40S RIBOSOMAL PROTEIN S15 4932
180 4V8Z 24 AP 40S RIBOSOMAL PROTEIN S15 4932
181 4V6W 13 AP 40S ribosomal protein S15, isoform A 7227
182 4V6X 13 AP 40S ribosomal protein S15 9606
184 4V6U 23 AT 30S ribosomal protein S19P 2261
185 4V6I 19 AR 40S ribosomal protein rpS15 (S19p) 4932
186 4V5Z 24 As 40S Ribosomal protein S15e 9612