Crystal structure of the human 40S ribosomal subunit in complex with DENR-MCT-1.

Sequence Similarity Clusters for the Entities in PDB 5VYC

Entity #1 | Chains: T1,T2,T3,T4,T5,T6
40S ribosomal protein S19 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 43 1080
95 % 1 85 698
90 % 1 85 721
70 % 1 85 752
50 % 1 87 764
40 % 1 87 792
30 % 3 90 775
Entity #10 | Chains: C1,C2,C3,C4,C5,C6
40S ribosomal protein S2 protein, length: 293 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 27 1779
95 % 1 40 1578
90 % 1 52 1239
70 % 1 53 1258
50 % 1 56 1236
40 % 1 56 1274
30 % 1 56 1308
Entity #11 | Chains: G1,G2,G3,G4,G5,G6
40S ribosomal protein S6 protein, length: 249 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 527
95 % 1 85 689
90 % 1 85 723
70 % 1 91 698
50 % 39 182 296
40 % 39 187 289
30 % 39 187 306
Entity #12 | Chains: J1,J2,J3,J4,J5,J6
40S ribosomal protein S9 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 515
95 % 1 85 683
90 % 1 85 710
70 % 39 185 250
50 % 41 200 236
40 % 41 208 236
30 % 41 208 246
Entity #13 | Chains: M1,M2,M3,M4,M5,M6
40S ribosomal protein S12 protein, length: 132 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 64 716
95 % 1 77 766
90 % 1 77 807
70 % 1 82 778
50 % 1 83 805
40 % 1 83 833
30 % 1 83 871
Entity #14 | Chains: N1,N2,N3,N4,N5,N6
40S ribosomal protein S13 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 518
95 % 1 85 690
90 % 1 85 709
70 % 39 190 248
50 % 41 197 246
40 % 41 205 239
30 % 41 206 248
Entity #15 | Chains: O1,O2,O3,O4,O5,O6
40S ribosomal protein S14 protein, length: 151 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 73 607
95 % 1 73 820
90 % 1 81 765
70 % 41 198 227
50 % 41 199 238
40 % 41 199 247
30 % 41 199 259
Entity #16 | Chains: W1,W2,W3,W4,W5,W6
40S ribosomal protein S15a protein, length: 130 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 502
95 % 1 86 679
90 % 1 86 704
70 % 40 201 234
50 % 42 203 231
40 % 43 212 230
30 % 391 808 23
Entity #17 | Chains: Y1,Y2,Y3,Y4,Y5,Y6
40S ribosomal protein S24 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 576
95 % 1 85 701
90 % 1 85 733
70 % 1 86 738
50 % 38 192 267
40 % 38 192 280
30 % 38 192 292
Entity #18 | Chains: Z1,Z2,Z3,Z4,Z5,Z6
40S ribosomal protein S25 protein, length: 125 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 57 813
95 % 1 57 1086
90 % 1 57 1129
70 % 1 58 1151
50 % 1 58 1192
40 % 1 59 1213
30 % 1 59 1257
Entity #19 | Chains: b1,b2,b3,b4,b5,b6
40S ribosomal protein S27 protein, length: 84 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 85 517
95 % 1 85 696
90 % 1 85 716
70 % 38 175 270
50 % 40 187 268
40 % 40 187 281
30 % 40 187 295
Entity #2 | Chains: U1,U2,U3,U4,U5,U6
40S ribosomal protein S20 protein, length: 119 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 885
95 % 1 56 1104
90 % 1 56 1149
70 % 1 57 1170
50 % 1 59 1162
40 % 1 59 1193
30 % 1 59 1234
Entity #20 | Chains: e1,e2,e3,e4,e5,e6
40S ribosomal protein S30 protein, length: 133 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 2 13434
95 % 1 31 1996
90 % 1 31 2014
70 % 1 31 2066
50 % 1 32 2068
40 % 1 32 2095
30 % 1 32 2126
Entity #21 | Chains: i1,i2,i3,i4,i5,i6
Human 18S ribosomal RNA rna, length: 1869 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
Entity #22 | Chains: A1,A2,A3,A4,A5,A6
40S ribosomal protein SA protein, length: 295 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 26 1879
95 % 1 54 1162
90 % 1 54 1208
70 % 1 54 1235
50 % 1 54 1283
40 % 1 54 1312
30 % 1 54 1357
Entity #23 | Chains: B1,B2,B3,B4,B5,B6
40S ribosomal protein S3a protein, length: 264 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 920
95 % 1 58 1081
90 % 1 58 1122
70 % 1 58 1159
50 % 1 60 1153
40 % 40 161 336
30 % 40 161 355
Entity #24 | Chains: D1,D2,D3,D4,D5,D6
40S ribosomal protein S3 protein, length: 243 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 41 1136
95 % 1 73 815
90 % 1 73 847
70 % 1 74 875
50 % 40 168 323
40 % 40 168 332
30 % 40 168 349
Entity #25 | Chains: E1,E2,E3,E4,E5,E6
40S ribosomal protein S4, X isoform protein, length: 263 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 54 875
95 % 1 73 819
90 % 1 85 718
70 % 38 181 261
50 % 40 191 255
40 % 40 195 258
30 % 40 204 254
Entity #26 | Chains: F1,F2,F3,F4,F5,F6
40S ribosomal protein S5 protein, length: 204 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 507
95 % 1 86 676
90 % 1 86 701
70 % 1 101 616
50 % 41 201 234
40 % 41 201 244
30 % 41 201 258
Entity #27 | Chains: H1,H2,H3,H4,H5,H6
40S ribosomal protein S7 protein, length: 194 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 521
95 % 1 85 693
90 % 1 85 725
70 % 1 86 737
50 % 38 188 272
40 % 38 188 285
30 % 40 191 282
Entity #28 | Chains: I1,I2,I3,I4,I5,I6
40S ribosomal protein S8 protein, length: 208 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 77 571
95 % 1 85 682
90 % 1 85 711
70 % 1 85 746
50 % 40 190 260
40 % 40 194 260
30 % 40 194 272
Entity #29 | Chains: K1,K2,K3,K4,K5,K6
40S ribosomal protein S10 protein, length: 165 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 51 925
95 % 1 53 1173
90 % 1 53 1215
70 % 1 53 1245
50 % 1 54 1269
40 % 1 55 1283
30 % 1 55 1318
Entity #3 | Chains: V1,V2,V3,V4,V5,V6
40S ribosomal protein S21 protein, length: 83 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 65 701
95 % 1 84 708
90 % 1 84 737
70 % 1 85 750
50 % 38 171 317
40 % 38 171 327
30 % 38 171 341
Entity #30 | Chains: L1,L2,L3,L4,L5,L6
40S ribosomal protein S11 protein, length: 158 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 497
95 % 1 86 673
90 % 1 86 702
70 % 1 87 729
50 % 41 197 244
40 % 41 197 253
30 % 41 197 264
Entity #31 | Chains: P1,P2,P3,P4,P5,P6
40S ribosomal protein S15 protein, length: 145 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 31 1548
95 % 1 84 705
90 % 1 84 739
70 % 1 86 741
50 % 40 179 302
40 % 40 187 286
30 % 40 187 304
Entity #32 | Chains: Q1,Q2,Q3,Q4,Q5,Q6
40S ribosomal protein S16 protein, length: 146 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 76 585
95 % 1 76 784
90 % 1 76 818
70 % 1 79 812
50 % 41 190 253
40 % 41 198 249
30 % 41 199 260
Entity #33 | Chains: R1,R2,R3,R4,R5,R6
40S ribosomal protein S17 protein, length: 135 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 29 1666
95 % 1 85 691
90 % 1 85 724
70 % 1 86 743
50 % 40 176 304
40 % 40 176 310
30 % 40 176 327
Entity #34 | Chains: S1,S2,S3,S4,S5,S6
40S ribosomal protein S18 protein, length: 152 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 86 496
95 % 1 86 672
90 % 1 86 700
70 % 39 183 254
50 % 41 192 252
40 % 41 202 242
30 % 41 202 255
Entity #35 | Chains: j1,j2,j3,j4,j5,j6
60S ribosomal protein L41 protein, length: 25 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 554
95 % 1 82 724
90 % 1 82 756
70 % 38 163 284
50 % 38 163 334
40 % 38 163 344
30 % 38 163 361
Entity #36 | Chains: k1,k2,k3,k4,k5,k6
Malignant T-cell-amplified sequence 1 protein, length: 181 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 11984
95 % 4 4 4065
90 % 4 4 4116
70 % 4 4 4092
50 % 4 4 4034
40 % 4 4 3988
30 % 4 4 3898
Entity #37 | Chains: l1,l2,l3,l4,l5,l6
Density-regulated protein protein, length: 198 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 3 3 5346
95 % 3 3 6334
90 % 3 3 6429
70 % 3 3 6325
50 % 3 3 6068
40 % 3 3 5909
30 % 3 3 5621
Entity #4 | Chains: X1,X2,X3,X4,X5,X6
40S ribosomal protein S23 protein, length: 143 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 84 522
95 % 1 88 659
90 % 1 89 677
70 % 41 204 222
50 % 41 214 221
40 % 41 214 227
30 % 41 214 235
Entity #5 | Chains: a1,a2,a3,a4,a5,a6
40S ribosomal protein S26 protein, length: 115 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 35 1334
95 % 1 49 1287
90 % 1 49 1326
70 % 1 50 1327
50 % 3 81 780
40 % 5 83 753
30 % 5 83 786
Entity #6 | Chains: c1,c2,c3,c4,c5,c6
40S ribosomal protein S28 protein, length: 69 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 67 678
95 % 1 67 906
90 % 1 67 941
70 % 39 191 247
50 % 41 202 232
40 % 41 203 241
30 % 41 203 252
Entity #7 | Chains: d1,d2,d3,d4,d5,d6
40S ribosomal protein S29 protein, length: 56 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 79 557
95 % 1 83 712
90 % 1 83 750
70 % 39 168 281
50 % 41 176 294
40 % 41 176 305
30 % 41 176 325
Entity #8 | Chains: f1,f2,f3,f4,f5,f6
Ribosomal protein S27a protein, length: 156 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 1 3 12188
95 % 1 50 1258
90 % 1 50 1295
70 % 4 82 724
50 % 6 86 729
40 % 6 89 728
30 % 6 89 758
Entity #9 | Chains: g1,g2,g3,g4,g5,g6
Receptor of activated protein C kinase 1 protein, length: 317 (BLAST)
Sequence Similarity Cutoff Rank Chains in Cluster Cluster ID / Name
100 % 2 85 495
95 % 2 85 663
90 % 2 85 693
70 % 3 87 711
50 % 46 176 280
40 % 48 182 271
30 % 48 183 283


In the table for each entity, view a list of similar sequences by selecting the link associated with the percentage cutoff.

View more detailed documentation on the redundancy reduction and sequence clustering procedure used by RCSB PDB.

You can also use the structure comparison tool to compare any 2 given structures

ACTION - (A) Select for download / view details OR (B) Select two chains for comparison
Rank PDB ID Entity ID Chains Description Details Taxonomy EC Number
1 4V88 17 AP, CP 40S ribosomal protein S15 4932
2 4U4R 17 C5, c5 40S ribosomal protein S15 4932
3 4U3U 17 C5, c5 40S ribosomal protein S15 4932
4 5TBW 64 Q, c5 40S ribosomal protein S15 4932
5 4U3M 17 C5, c5 40S ribosomal protein S15 4932
6 4U3N 17 C5, c5 40S ribosomal protein S15 4932
7 4U52 17 C5, c5 40S ribosomal protein S15 4932
8 4U4Q 17 C5, c5 40S ribosomal protein S15 4932
9 4U6F 17 C5, c5 40S ribosomal protein S15 4932
10 4U4U 17 C5, c5 40S ribosomal protein S15 4932
11 4U4Z 17 C5, c5 40S ribosomal protein S15 4932
12 4U4Y 17 C5, c5 40S ribosomal protein S15 4932
13 4U4N 17 C5, c5 40S ribosomal protein S15 4932
14 4U55 17 C5, c5 40S ribosomal protein S15 4932
15 5DAT 17 C5, c5 40S ribosomal protein S15 4932
16 5I4L 17 C5, c5 40S ribosomal protein S15 4932
17 4U51 17 C5, c5 40S ribosomal protein S15 4932
18 6HHQ 63 Q, c5 40S ribosomal protein S15 4932
19 5OBM 61 C5, c5 40S ribosomal protein S15 4932
20 4U53 17 C5, c5 40S ribosomal protein S15 4932
21 5ON6 65 Q, c5 40S ribosomal protein S15 4932
22 4U50 17 C5, c5 40S ribosomal protein S15 4932
23 5NDV 61 C5, c5 40S ribosomal protein S15 4932
24 5LYB 17 C5 40S ribosomal protein S15 4932
25 5LYB 82 c5 40S ribosomal protein S15 4932
26 4U56 17 C5, c5 40S ribosomal protein S15 4932
27 5TGA 17 C5, c5 40S ribosomal protein S15 4932
28 5MEI 64 Q, c5 40S ribosomal protein S15 4932
29 5FCJ 17 C5, c5 40S ribosomal protein S15 (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SQAVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMR NMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLK 4932
30 4U4O 17 C5, c5 40S ribosomal protein S15 4932
31 5DGV 17 C5, c5 40S ribosomal protein S15 4932
32 5DGE 17 C5, c5 40S ribosomal protein S15 4932
33 5NDW 10 C5, c5 40S ribosomal protein S15 4932
34 5NDG 17 C5, c5 40S ribosomal protein S15 4932
35 5FCI 17 C5, c5 40S ribosomal protein S15 (UNK) residues correspond to residues that aren't well resolved, and for which side-chains could not be modeled. (UNK)s were substituted in the original sequence of the crystallized protein. Remaining misalignments result from differences in the distribution of (UNK)s between the two instances of the molecule in the structure. Here is the original sequence ot the crystallized protein : SQAVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMR NMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLK 4932
36 5DC3 17 C5, c5 40S ribosomal protein S15 4932
37 5DGF 17 C5, c5 40S ribosomal protein S15 (uS19) 4932
38 5TGM 17 C5, c5 40S Ribosomal Protein S15,40S ribosomal protein S15,40S Ribosomal Protein S15 4932
39 4V7R 10 AI, CI 40S ribosomal protein S15 4932
40 5VYC 31 P1, P2, P3, P4, P5, P6 40S ribosomal protein S15 9606
41 4KZZ 16 P 40S Ribosomal Protein S15 9986
42 4KZX 16 P 40S ribosomal protein S15 9986
43 4KZY 16 P 40S Ribosomal Protein S15 9986
44 6YAL 40 R 40S ribosomal protein uS19 9986
45 6YAM 40 R 40S ribosomal protein uS19 9986
46 6YAN 38 R Ribosomal protein S15 9986
47 6W2S 25 Q uS19 9986
48 6W2T 24 Q uS19 9986
49 6Y7C 15 P 40S ribosomal protein S15 4932
50 6Y57 64 SP 40S ribosomal protein S15 9606
51 6Y2L 64 SP 40S ribosomal protein S15 9606
52 6Y0G 65 SP 40S ribosomal protein S15 9606
53 6TNU 5 E 40S ribosomal protein S15 4932
54 6UZ7 63 P KLLA0F07843p 28985
55 6TB3 5 E 40S ribosomal protein S15 4932
56 6T83 4 Pb, q 40S ribosomal protein S15 4932
57 6T7T 6 SP 40S ribosomal protein S15 4932
58 6T7I 4 SP 40S ribosomal protein S15 4932
59 6T4Q 3 SP 40S ribosomal protein S15 4932
60 6SV4 34 E, Eb, Ec 40S ribosomal protein S15 4932
61 6SNT 4 P 40S ribosomal protein S15 4932
62 6SGC 17 Q1 uS19 9986
63 6S47 61 BQ 40S ribosomal protein S15 4932
64 6P5I 17 Q uS19 9986
65 6P5J 17 Q uS19 9986
66 6P5K 63 Q uS19 9986
67 6P5N 63 Q uS19 9986
68 6P4G 17 Q uS19 9986
69 6P4H 18 Q uS19 9986
70 6OM7 11 SP 40S ribosomal protein S15 9606
71 6OLZ 62 BP 40S ribosomal protein S15 9606
72 6OM0 11 SP 40S ribosomal protein S15 9606
73 6OLE 11 SP 40S ribosomal protein S15 9606
74 6OLF 11 SP 40S ribosomal protein S15 9606
75 6OLG 65 BP 40S ribosomal protein S15 9606
76 6OLI 11 SP 40S ribosomal protein S15 9606
77 6OKK 24 X 40S ribosomal protein S19 5833
78 6RBD 28 P 40S ribosomal protein S15 4932
79 6RBE 25 P 40S ribosomal protein S15 4932
80 6R7Q 85 WW uS19 9986
81 6R6G 56 WW uS19 9986
82 6R6P 76 9 uS14 9986
83 6R5Q 67 WW uS17 9986
84 6QZP 58 SP 40S ribosomal protein S15 9606
85 6Q8Y 61 E 40S ribosomal protein S15 4932
86 6I7O 34 E, Eb 40S ribosomal protein S15 4932
87 6IP5 57 2w 40S ribosomal protein S15 9606
88 6IP6 56 2w 40S ribosomal protein S15 9606
89 6IP8 56 2w 40S ribosomal protein S15 9606
90 6MTB 66 PP 40S ribosomal protein S15 9986
91 6MTC 65 PP 40S ribosomal protein S15 9986
92 6MTD 67 PP uS19 9986
93 6MTE 66 PP uS19 9986
94 6HCQ 20 Q2 uS19 9986
95 6HCJ 20 Q2 uS19 9986
96 6HCM 17 Q1 uS19 9986
97 6HCF 17 Q1 uS19 9986
98 6GZ3 10 BP ribosomal protein uS19 9986
99 6GZ4 16 BP ribosomal protein uS19 9986
100 6GZ5 10 BP ribosomal protein uS19 9986
101 6GSM 19 P KLLA0F07843p 28985
102 6GSN 7 P KLLA0F07843p 28985
103 6GQV 63 AF 40S ribosomal protein S15 4932
104 6GQ1 63 AF 40S ribosomal protein S15 4932
105 6GQB 63 AF 40S ribosomal protein S15 4932
106 6D9J 65 QQ uS19 9986
107 6D90 66 QQ uS19 9986
108 6G5H 26 P 40S ribosomal protein S15 9606
109 6G5I 17 P 40S ribosomal protein S15 9606
110 6G4S 26 P 40S ribosomal protein S15 9606
111 6G4W 22 P 40S ribosomal protein S15 9606
112 6G51 30 P 40S ribosomal protein S15 9606
113 6G53 29 P 40S ribosomal protein S15 9606
114 6G18 4 P 40S ribosomal protein S15 9606
115 6FYX 19 P KLLA0F07843p 28985
116 6FYY 19 P KLLA0F07843p 28985
117 6FEC 42 n 40S ribosomal protein S15 9606
118 6FAI 26 P 40S ribosomal protein S15 4932
119 6EML 5 E 40S ribosomal protein S15 4932
120 6EK0 58 SP 40S ribosomal protein S15 9606
121 6AZ1 23 W ribosomal protein S19 5661
122 5OPT 4 t 40S ribosomal protein S15, putative 5693
123 5XXU 17 P Ribosomal protein uS19 5811
124 5OA3 20 P 40S ribosomal protein S15 9606
125 5MC6 6 E 40S ribosomal protein S15 4932
126 5M1J 23 P2 40S ribosomal protein S15 4932
127 5LZS 66 PP uS19 9986
128 5LZT 67 PP uS19 9986
129 5LZU 66 PP uS19 9986
130 5LZV 67 PP uS19 9986
131 5LZW 67 PP uS19 9986
132 5LZX 67 PP uS19 9986
133 5LZY 65 PP uS19 9986
134 5LZZ 67 PP uS19 9986
135 5T2A 64 AI uS19 5661
136 5T2C 74 Ax 40S ribosomal protein S15 9606
137 5LKS 57 SP 40S ribosomal protein S15 9606
138 5K0Y 36 n ribosomal protein uS19 9986
139 5JUO 65 MB uS19 (yeast S15) 4932
140 5JUP 65 MB uS19 (yeast S15) 4932
141 5JUS 65 MB uS19 (yeast S15) 4932
142 5JUT 65 MB uS19 (yeast S15) 4932
143 5JUU 65 MB uS19 (yeast S15) 4932
144 5IT7 63 P KLLA0F07843p 28985
145 5IT9 16 P Ribosomal protein uS19 28985
146 5FLX 17 P 40S RIBOSOMAL PROTEIN S15 9986
147 3JAP 19 P uS19 28985
148 3JAQ 19 P uS19 28985
149 3JAM 17 P uS19 28985
150 3JAG 67 PP uS19 9986
151 3JAH 67 PP uS19 9986
152 3JAI 67 PP uS19 9986
154 4UG0 58 SP 40S RIBOSOMAL PROTEIN S15 9606
155 5AJ0 65 BP 40S ribosomal protein S15 9606
156 4UER 29 S US19 4934
157 4D61 17 P 40S RIBOSOMAL PROTEIN S15 9986
158 4D5L 17 P 40S RIBOSOMAL PROTEIN US19 9986
159 3J81 17 P uS19 28985
160 3J80 24 P uS19 28985
161 3J7P 65 SP Ribosomal protein uS19 9823
162 3J7R 66 SP Ribosomal protein uS19 9823
165 3J7A 24 X 40S ribosomal protein uS19 5833
166 3J77 61 15 40S ribosomal protein S15 4932
167 3J78 61 15 40S ribosomal protein S15 4932
168 3J6X 62 15 40S ribosomal protein S15 4932
169 3J6Y 62 15 40S ribosomal protein S15 4932
171 4V92 18 BP US19 28985
172 4V7E 21 BP 40S ribosomal protein S19 4565
173 4V8Y 24 AP 40S RIBOSOMAL PROTEIN S15 4932
174 4V8Z 24 AP 40S RIBOSOMAL PROTEIN S15 4932
175 4V6W 13 AP 40S ribosomal protein S15, isoform A 7227
176 4V6X 13 AP 40S ribosomal protein S15 9606
178 4V6I 19 AR 40S ribosomal protein rpS15 (S19p) 4932
179 4V5Z 24 As 40S Ribosomal protein S15e 9612